KEGG   Methylorubrum extorquens CM4: Mchl_4661Help
Entry
Mchl_4661         CDS       T00809                                 

Definition
(GenBank) enoyl-acyl carrier protein reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mch  Methylorubrum extorquens CM4
Pathway
mch00061  Fatty acid biosynthesis
mch00780  Biotin metabolism
mch01100  Metabolic pathways
mch01130  Biosynthesis of antibiotics
mch01212  Fatty acid metabolism
Module
mch_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Mchl_4661
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Mchl_4661
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Mchl_4661
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mch01004]
    Mchl_4661
Enzymes [BR:mch01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Mchl_4661
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Mchl_4661
Lipid biosynthesis proteins [BR:mch01004]
 Fatty acid synthase
  Component type
   Mchl_4661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ACK85435
UniProt: B7KQ42
LinkDB All DBs
Position
complement(4943139..4943966)
Genome map
AA seq 275 aa AA seqDB search
MSEQKPGGLLAGKRGLVLGVANNRSIAWGIARSAAAHGAELAFTYQGEALKKRVEPLARE
LNAHVVGHCDVTDPASIDSAFAATAEVFPDGIDFVVHCIAFSDKDELTGRYLETSEANFT
KSLLISCYSFTAVAQRAEKIMRNGGSMLTLTYYGAEKWMPHYNVMGVAKAALEASVRYLA
ADLGPKQIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPMRRTVTIEEVGETAAYLFS
DMSRGMTGEILHVDAGYHVVGMKNPDAPDITRERE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaacagaagccgggcgggctgctcgcgggcaagcgcgggctggtgttgggagtg
gccaacaaccgctcgatcgcctggggtatcgcccgtagcgctgccgcgcacggggcggaa
ttggcgttcacctaccagggcgaggcgctgaagaagcgcgtcgagccgctggcgcgcgag
ttgaacgcgcatgtcgtcggccattgcgacgtcaccgatcccgcctcgatcgattccgcc
ttcgccgcgaccgccgaggtgttcccggacgggatcgatttcgtcgtccactgcatcgcc
ttctccgacaaggacgagctgacggggcgctatctcgagacctcggaggcgaacttcacc
aagtcgctgctgatctcgtgctactcgttcacggcggtggcgcagcgcgcggaaaagatc
atgcgcaacggcgggtcgatgctgaccctgacctattacggcgccgagaagtggatgccc
cactacaacgtgatgggtgtcgccaaggccgcgctggaagcctccgtacgctacctcgcc
gccgatctcgggccgaagcagatccgcgtcaacgcgatctcggccgggccgatcaagacg
ctggcggcctccggcatcggcgacttccgctacattctcaagtggaacgagtacaacgcg
ccgatgcgccggaccgtgaccattgaggaggtcggcgagacggcagcctacctgttctcc
gacatgtcccgcggcatgaccggcgagatcctccacgtcgatgccggctaccacgtcgtc
ggcatgaagaaccccgacgcgccggatatcacccgcgagcgggaatag

DBGET integrated database retrieval system