KEGG   Methylorubrum extorquens CM4: Mchl_4855Help
Entry
Mchl_4855         CDS       T00809                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mch  Methylorubrum extorquens CM4
Brite
KEGG Orthology (KO) [BR:mch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mch03012]
    Mchl_4855
   03029 Mitochondrial biogenesis [BR:mch03029]
    Mchl_4855
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mch04147]
    Mchl_4855
Translation factors [BR:mch03012]
 Eukaryotic Type
  Elongation factors
   Mchl_4855
 Prokaryotic Type
   Mchl_4855
Mitochondrial biogenesis [BR:mch03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Mchl_4855
Exosome [BR:mch04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Mchl_4855
  Exosomal proteins of breast cancer cells
   Mchl_4855
  Exosomal proteins of colorectal cancer cells
   Mchl_4855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACK85620
UniProt: B7KSF2
LinkDB All DBs
Position
complement(5165588..5166778)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFSRTKPHCNIGTIGHVDHGKTSLTAAITKVLAESGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETTNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDMVDDEELLELVELEVRELLSKYDFPGDDIPITKGSALMALE
DKEPKIGKEAVLALMATVDEYIPQPERPIDMPFLMPIEDVFSISGRGTVVTGRVERGIVK
VGESVEIVGIRPTTTTTVTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVVCKPGS
VKPHSKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVCTLPEGTEMVMPGDNVT
MDVVLIVPVAMEEKLRFAIREGGRTVGAGVVAAIND
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagttctcccgtaccaagccgcactgcaacatcggcacgatcgggcac
gtggatcacggcaagacgtcgctgacggcggcgatcacgaaggttctggcggagtcgggc
ggggcgaccttcacggcctacgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatctcgaccgcccacgtcgagtacgagacgaccaaccgccactacgcgcacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggtgccgcccagatggac
ggcgcgatcctggttgtgtccgccgccgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgtcaggtcggcgtgccggcgctggtggtgttcctcaacaaggtcgacatg
gtcgatgacgaggagctcctggagctggtcgagctggaggtgcgcgagctcctctccaag
tacgacttccccggcgacgacatcccgatcaccaagggctcggccctgatggcgctcgag
gacaaggagcccaagatcggcaaggaagccgttctggcgctgatggcgacggtcgacgag
tacatcccgcagccggagcgtccgatcgacatgccgttcctgatgccgatcgaggacgtg
ttctcgatctcgggccgcggcacggtggtgacgggtcgcgtcgagcgcggcatcgtcaag
gtcggtgagtcggtggagatcgtcggcatccgtccgacgacgacgacgacggtgaccggc
gtcgagatgttccgcaagctgctcgaccagggccaggcgggcgacaacgtcggcgtgctg
ctgcgcggcacgaagcgcgaggacgtggagcgcggccaggtcgtgtgcaagccgggttcg
gtcaagccgcactcgaagttcaaggccgaggcctacatcctgacgaaggaagagggcggc
cgccacacgccgttcttcaccaactaccgcccgcagttctacttccgcacgacggacgtg
accggcgtgtgcacgctgcccgagggcaccgagatggtgatgccgggcgacaacgtgacc
atggacgtggtgctgatcgtgccggtggccatggaagagaagctgcgcttcgccatccgc
gagggtggtcgcaccgtcggtgccggcgtcgtcgccgccatcaacgactga

DBGET integrated database retrieval system