KEGG   Methylorubrum extorquens CM4: Mchl_4958Help
Entry
Mchl_4958         CDS       T00809                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
mch  Methylorubrum extorquens CM4
Pathway
mch00910  Nitrogen metabolism
mch02010  ABC transporters
Module
mch_M00438  Nitrate/nitrite transport system
mch_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:mch00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Mchl_4958
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mchl_4958
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mch02000]
    Mchl_4958
Transporters [BR:mch02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Mchl_4958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACK85723
UniProt: B7KTA3
LinkDB All DBs
Position
complement(5293309..5294166)
Genome map
AA seq 285 aa AA seqDB search
MATGATLTATRERAAKARTPFITMAGLRGVAARVLPPLVVLAGFLLLWEVLCSSPTAGLP
PPSRVMTEAWDIIIDPFYDNGGTDKGLFWHIAASLKRVALGFSLAVVAGVMLGTLVGQSD
WAMRGLDPIFQILRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSIWPIIINTAVGIRNIP
QDYRNVAAVIRLNPIEFFVKIMLPSAAPYIFTGLRIGVGLSWLAIVAAEMLIGGVGIGFF
IWDAWNSSHISEIIVALVYVGLIGFVLDRMVAGLGVLVTRGTSAA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctaccggagcaacgctcaccgcaacccgcgaacgcgccgccaaggcccgcacgccc
ttcatcaccatggctgggctgcgcggcgttgccgcccgcgtcctgccgccgctcgtcgtc
ctggcgggcttcctgctcctgtgggaggtgctgtgctcctcccccaccgccggcctgccg
ccgccctcgcgggtgatgacggaagcctgggacatcatcattgacccgttctacgacaac
ggcggcaccgacaagggcctgttctggcatatcgccgcgagcctgaagcgcgtggcgctg
ggcttctcgctggcggtggtggcgggcgtgatgctcggcacgctggtcggccagtccgac
tgggcgatgcgcgggctcgacccgatcttccagatcctgcgcacgatcccgccgctggcg
tggctcccgctctcgctcgccgccttccgcgacggccaaccgagcgcgatcttcgtgatc
ttcatcacctcgatctggccgatcatcatcaacaccgcggtcggcattcgcaacattccg
caagactaccgcaacgtcgccgcggtcatccggctgaacccgatcgagttcttcgtgaag
atcatgctgccctcggcggccccctacatcttcaccggtcttcgcatcggcgtcggcctg
tcctggctcgccatcgtcgcggccgaaatgctgatcggcggcgtcgggatcggcttcttc
atctgggatgcgtggaactcgtcgcacatctccgagatcatcgtcgccctcgtctatgtc
gggctcatcggcttcgtcctcgaccggatggtcgccgggctcggcgtgctcgtgacccgc
ggcaccagcgcagcgtga

DBGET integrated database retrieval system