KEGG   Momordica charantia (bitter melon): 111007279Help
Entry
111007279         CDS       T05045                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00010  Glycolysis / Gluconeogenesis
mcha00053  Ascorbate and aldarate metabolism
mcha00071  Fatty acid degradation
mcha00280  Valine, leucine and isoleucine degradation
mcha00310  Lysine degradation
mcha00330  Arginine and proline metabolism
mcha00340  Histidine metabolism
mcha00380  Tryptophan metabolism
mcha00410  beta-Alanine metabolism
mcha00561  Glycerolipid metabolism
mcha00620  Pyruvate metabolism
mcha00903  Limonene and pinene degradation
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111007279
   00053 Ascorbate and aldarate metabolism
    111007279
   00620 Pyruvate metabolism
    111007279
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111007279
   00561 Glycerolipid metabolism
    111007279
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111007279
   00310 Lysine degradation
    111007279
   00330 Arginine and proline metabolism
    111007279
   00340 Histidine metabolism
    111007279
   00380 Tryptophan metabolism
    111007279
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111007279
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    111007279
Enzymes [BR:mcha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111007279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 111007279
NCBI-ProteinID: XP_022135275
LinkDB All DBs
Position
Unknown
AA seq 543 aa AA seqDB search
MAARRGISSLLSRSLSSSSGYGFSSLLLSQGRVSSFHGRGNRFSTSAVAEEELVTPPVQI
SYTQHLINGQFVDAASGKTFPTYDPRTGEVIAHVAEGDAEDINRAVVAARKAFDEGPWPR
MSAYERSRILLRFADLVEKHSLELAALETWNNGKPYEQSAKSELPTVVRLFHYYAGWADK
IHGLTVPADGQHHVQILHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNAIVLKTAEQTP
LTALYVAKLFHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLAFTGSTDTGKIVLELAA
KSNLKPVTLELGGKSPFIVCEDADVDKAVELAHFALFYNQGQCCCAGSRTYVHERVYDEF
VEKSKARAQRRIVGDPFKKGVEQGPQIDSEQFEKVLRYIKCGVESNASLECGGDRLGSKG
YFIQPTVFSNVKDDMLIAKDEIFGPVQSILKFKDIHEVIQRANSSRFGLAAGVFTKNIDT
ANTLTRALKAGTVWVNCFDIFDAAIPFGGYKMSGIGREKGVYSLQNYLQVKAVVTPLKNP
AWL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcgcagaggaatctcttctttactctctcgctctctctcttcttcttctggt
tatgggttttcttctcttcttctttctcaaggaagggtttcaagcttccatggaagagga
aacagattcagcacatctgctgtggcagaggaggagcttgtcactcctcctgttcagata
agttacactcaacatctgattaatgggcagtttgtggatgctgcttcagggaaaacgttt
cctacctacgacccccggaccggggaagtgattgctcatgttgccgagggcgatgccgag
gatatcaaccgcgctgtagtggcagctcgcaaggcttttgacgaggggccatggccgaga
atgagtgcttatgaacgatcgaggatattactgcggtttgcggatttggttgagaaacat
agccttgaacttgcagcattggagacatggaacaatgggaaaccttacgaacaatcggcc
aaatctgaattaccgacagttgttcgcctgtttcactattacgccggctgggcagacaaa
atccatggcttgacagttccagcagatgggcaacatcatgtgcaaatattacatgaacca
attggagttgcaggacagataattccatggaactttcctctccttatgtttgcttggaaa
gttggtcctgctctagcctgtggcaacgccattgtcctgaagactgcagagcaaacacct
ctgactgccctttatgtggcaaagctattccacgaggctggtcttcctccaggggttctg
aatgttgtttcaggctatggtccgacggccggtgctgcccttgctagccatatggatgta
gacaagctagctttcacaggatccacagacacaggaaaaattgtgcttgaattggcggcg
aaaagcaatcttaagccagtaacgctagaacttggagggaaatcacctttcatcgtttgt
gaggatgcagatgtcgacaaggctgtggagcttgctcattttgctcttttttacaatcag
gggcaatgttgctgtgctgggtctcgtacttacgtgcacgagcgtgtatatgacgaattt
gtcgagaaatcaaaggcacgtgctcaaaggcgcatagttggcgaccctttcaagaagggt
gttgaacagggtcctcagattgactcggagcaatttgaaaaagttctaagatacataaaa
tgtggcgttgaaagtaatgctagtctggaatgtggaggtgatagacttggctctaaggga
tacttcatccagccaacagttttctcaaatgttaaggacgatatgttaatagcaaaggat
gaaatctttggccctgtacaatccatcttgaaattcaaggacatccatgaagtaattcaa
agggcaaactcaagtcgcttcggtctagctgcgggagttttcactaagaacatagacacg
gccaacaccctaacccgagcgttgaaagctggaactgtgtgggtcaattgcttcgacatc
ttcgacgctgcaataccgtttggcgggtataagatgagcggaatagggagggagaaggga
gtttacagccttcaaaactatttgcaggtgaaggctgttgttactcctctgaagaaccca
gcatggttgtga

DBGET integrated database retrieval system