KEGG   Momordica charantia (bitter melon): 111008690Help
Entry
111008690         CDS       T05045                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00250  Alanine, aspartate and glutamate metabolism
mcha00410  beta-Alanine metabolism
mcha00430  Taurine and hypotaurine metabolism
mcha00650  Butanoate metabolism
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
Module
mcha_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111008690
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111008690
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111008690
   00430 Taurine and hypotaurine metabolism
    111008690
Enzymes [BR:mcha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     111008690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 111008690
NCBI-ProteinID: XP_022137143
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MVLTTVADSGDSVNCTFGSRYLRSPPPKFKLGEKSIPKDAAYQIIHDELMLDGAPRLNLA
SFVTTWMEPECDHLISASLNKNYVDMDEYPVTTELQNRCVNMIAHLFHAPVGEEEAAVGV
GTVGSSEAIMLAGLAFKRKWQNKRKSQGKPYHNPNIVTGANVQVCWEKFARYFEVELKEV
KLSEGFYVMDPVKAVELVDENTICVAAILGSTLTGEFEDVKLLNDLLSKKNKETGWDTPI
HVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSKEDLPEELV
FHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNVMENCRENARVLREGIEKM
GRFEVVSKDIGVPLVAFTLKDSSKHTVFEISENLRRFGWIVPAYTMPPNAEHIAVLRVVI
REDFSRGLAERLISDVEKVLKDVDALPVRVSVKAAEVKPGVEDGGRITKHVKKSEREIEE
EITAYWRRLVDGKRTGAC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggttttgacgacagttgcagactcgggagattctgtgaactgcacttttggttccaga
tatctccgctctcctcctcccaagttcaaactgggggagaaatctatacccaaggatgca
gcgtaccagatcatacacgatgagttgatgctggacggggcaccgaggctgaacttggcc
tctttcgttaccacgtggatggagccagagtgcgatcaccttatttccgcttctctgaac
aagaactatgttgacatggacgagtacccagtcaccactgagctacagaatcgatgtgtg
aatatgatagcccacctgttccatgcccccgtcggagaagaagaagctgcagttggtgtg
gggactgtgggatcatcagaggctataatgctggccggccttgcttttaagaggaaatgg
cagaacaaaagaaaatctcaaggcaaaccctatcataacccaaacatagtcactggagct
aatgtgcaggtgtgctgggagaagtttgcaaggtactttgaggtcgagctaaaggaggtg
aagctttctgaaggattctatgtcatggatccagtgaaggctgtcgaactcgttgatgaa
aataccatctgtgttgcagcaattttgggttccactctgactggagagtttgaggatgta
aaactcctcaacgacctcctctctaagaagaataaggaaacaggttgggacaccccaatt
catgtggatgctgccagtggagggtttatagccccgttcctttatcccgatctcgagtgg
gattttcggttgcctttagtgaagagcattaatgtgagtggccataagtatggtcttgtt
taccctggtgtaggatgggttgtttggaggagtaaagaggatcttccagaggagcttgtg
ttccacattaactatcttggctccgatcaacccaccttcactctcaacttctcaaaaggt
tctagtcaaattatagctcagtattatcaatttatacggcttgggtttgagggctacaaa
aacgtgatggagaactgcagggagaacgctcgagttctgagagaggggatagagaagatg
ggaaggtttgaggtcgtttctaaggatattggggtgcccctggtagccttcactctcaaa
gacagtagcaagcacacagtgttcgagatatcagagaacctgaggaggtttggatggatc
gtgccagcttacacgatgcccccgaatgctgagcacatcgccgtcctgagagtggtcatc
agggaggacttcagccgtgggttggcagagaggctgatctccgacgtcgagaaagtcctc
aaggatgtggacgccctgccagttcgggtgtctgtgaaggcagcggaagtgaagcctggt
gttgaagatggtgggagaattacaaagcatgtgaagaagagtgagcgggagatcgaggag
gagataactgcatattggaggcggcttgtggatggcaagaggactggtgcctgctaa

DBGET integrated database retrieval system