KEGG   Momordica charantia (bitter melon): 111011122Help
Entry
111011122         CDS       T05045                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha03030  DNA replication
mcha03410  Base excision repair
mcha03420  Nucleotide excision repair
mcha03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111011122
   03410 Base excision repair
    111011122
   03420 Nucleotide excision repair
    111011122
   03430 Mismatch repair
    111011122
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcha03032]
    111011122
   03400 DNA repair and recombination proteins [BR:mcha03400]
    111011122
Enzymes [BR:mcha01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111011122
    6.5.1.6  DNA ligase (ATP or NAD+)
     111011122
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111011122
DNA replication proteins [BR:mcha03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111011122
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111011122
DNA repair and recombination proteins [BR:mcha03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111011122
   NER (nucleotide excision repair)
    Other NER factors
     111011122
   MMR (mismatch excision repair)
    Other MMR factors
     111011122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 111011122
NCBI-ProteinID: XP_022140452
LinkDB All DBs
Position
Unknown
AA seq 806 aa AA seqDB search
MLSLRSCYYLRPVTIALPHPQFKKLIFFNKTHSFKPILPNFVSAMSSRPSAFDALMSGAR
AAAKKKSATSTSSPKKRKALDSLDPSPKPSSSHTLESMLPVESQCGNSILDNPGGSHLGT
AENAVDLGETKLGQDNGGSVGTKNGPAGSKTCATSVQERTAKLKSSIPELKKKAKDFNSK
NVACWKEGERVPCLFLCLGFDMISEESSRIVITDIVCNMLRTVMDTTPDDLVATVYLLAN
KIAPAHEGLELGIGDSSIIKALSEAFGRTEAQVKKQYKELGDLGLVAKASRSSQSMMRKP
DALTIAKVFDTFRLIAKESGKDSQEKKKNHIKSLLVAATDCEPLYLIRLLQTKLRIGLAE
QTLLAALGQAAVYAEKHSTPPPNIQSPLEEAAKTVKQVYSILPVYDKLVPALLTGGVWNL
SKTCNFTPGIPIGPMLAKPTKGVSEILNKFQDLEFTCEYKYDGERAQIHYLENGSVEIYS
RNAERNTGKFPDVVLTVSRVKKPSVRSFILDCELVAYDRGKQKILPFQILSTRARKNVAV
SDIKVDVCVFAFDLLYLDGQPLIQRELNVRRELLYDSFMEEPGYFQFATAILTNDLEEIQ
KFLDASVDESCEGLIIKTLNRDSTYEPSKRSHNWLKLKKDYIDSIGDSLDLVPIAAFHGR
GKRTGVYGAFLLACYDNDNEEFQSICKIGTGFSEAMLEERSTSLRSKVITEPKSYYRYGD
TINPDVWFEPTEVWEVKAADLTISPVHRAGVGIVDSDKGISLRFPRLVRVRQDKTPEEAS
SSEQVADMYNAQKLNHQNNRDDKDDD
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgctttcactgcgttcatgttactatctacgccccgttacaatcgcattgcctcatccc
caattcaagaaactcattttcttcaacaaaactcattctttcaaacccatcctcccgaat
tttgtttccgcaatgtcttctcgtccttcggctttcgatgctctcatgtctggtgctcgg
gccgctgccaagaagaagtctgcaacttcaacttcttctcccaagaagcgtaaagcccta
gattctttagacccttctccaaaacctagctcctcccacactttggagtcaatgctgcct
gttgaatcgcagtgcggcaactcaattttggacaatcctggaggttctcatctgggaacg
gccgagaacgcggtggatttgggagaaaccaagttgggtcaagataatggcggcagtgtt
ggaaccaagaatgggccggcggggagtaaaacgtgcgcgacaagtgttcaagaaagaact
gcgaaattgaagagttctattccagaattgaaaaagaaagccaaggatttcaactcgaaa
aatgttgcgtgttggaaagagggcgaacgggtcccctgtttgtttctgtgtctgggcttc
gacatgatttctgaggagtctagtaggattgttatcaccgatattgtgtgtaacatgttg
aggaccgtcatggataccacacccgacgacttggtggccactgtatatcttttggctaat
aagattgctccagcccacgaagggcttgagttggggattggggattcctctattatcaaa
gctctttctgaggcttttggaaggacagaggcgcaggttaaaaaacagtacaaggaacta
ggagatttaggtcttgttgccaaagcgagccgttcatcgcagtccatgatgcgaaagcct
gatgctttaactattgccaaagtatttgacacatttcggctgattgctaaggaatctggc
aaggatagtcaagagaagaaaaagaaccatatcaagtcactgcttgttgctgccacagac
tgtgaacctttatatctgattagattgctgcagacaaaattgcgaattggacttgctgaa
cagactcttttagctgcattaggccaagctgctgtgtatgctgaaaaacactctacgcca
ccaccaaacattcaatctcctctagaagaggctgctaagactgtaaagcaagtgtattct
atactcccagtttatgataaacttgtccctgcacttcttactggtggtgtgtggaatctt
tcaaaaacatgcaactttacaccaggtattccaattggacccatgctagcaaaaccaaca
aagggagtgtccgagatcttaaataaattccaggatttggaatttacttgtgaatacaaa
tatgatggtgaacgtgcacagatacattacttggaaaatggttcagttgagatatacagt
cgaaatgctgaacgaaacactggaaagttccccgatgttgttctaacggtatcaagggta
aagaaaccatctgtaagatcgtttattttggattgtgaacttgttgcttatgatcgtgga
aaacagaagattctgcctttccagattctgagtactcgagctcgcaagaacgtggccgtg
agtgatattaaggttgatgtgtgtgtatttgcctttgatttattatatcttgatggtcaa
ccacttattcagagagaacttaatgttcgtcgagagcttctctatgattcatttatggaa
gaacctgggtattttcaatttgccaccgcaatattaacaaacgatcttgaggaaatacag
aaattccttgatgcatctgttgatgaaagttgtgaaggtttaattatcaaaacattgaat
agagattctacttatgagccatccaagaggtcacataactggttaaaactgaagaaggac
tacatagacagcataggggattcacttgatctggtaccaattgctgccttccatggccgt
gggaagcgtacaggtgtctatggcgcattcctccttgcttgttacgacaatgataatgaa
gaatttcaaagcatttgtaagataggaactggkttttctgaagcaatgcttgaggaacgt
tctactagtcttcgttctaaagtcattactgaaccgaagtcatattatcggtatggagat
acaatcaatccggatgtttggtttgagcctacggaggtttgggaggttaaagcagcagac
ttgactattagcccagttcaccgtgcaggagttggcattgtggattctgataagggaatt
tctcttcggtttccacgtcttgttcgtgtaaggcaagacaaaactccagaggaagcttca
tcatcagagcaggttgccgacatgtataatgctcaaaaactcaaccatcaaaataatcga
gatgataaagatgacgactga

DBGET integrated database retrieval system