KEGG   Momordica charantia (bitter melon): 111011275Help
Entry
111011275         CDS       T05045                                 

Definition
(RefSeq) aminoacylase-1
  KO
K14677  aminoacylase [EC:3.5.1.14]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00220  Arginine biosynthesis
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
mcha01210  2-Oxocarboxylic acid metabolism
mcha01230  Biosynthesis of amino acids
Module
mcha_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111011275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcha01002]
    111011275
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcha04147]
    111011275
Enzymes [BR:mcha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.14  N-acyl-aliphatic-L-amino acid amidohydrolase
     111011275
Peptidases [BR:mcha01002]
 Metallo Peptidases
  Family M20
   111011275
Exosome [BR:mcha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111011275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28 M20_dimer
Motif
Other DBs
NCBI-GeneID: 111011275
NCBI-ProteinID: XP_022140673
LinkDB All DBs
Position
Unknown
AA seq 448 aa AA seqDB search
MNLKYVNLLLSVITIFLFLSSSIADEESSSSSAIIARFQQYLQINTVQPNPHYYEAADFI
ISQAKSLALESQTIEFVEGKPLILLKWPGSNPDLSSILLNSHTDVVPAEHHKWTHPPLGA
HIDSLGNIYARGSQDMKCVGMQYLEAIRRLKALGFEPARSVYLSFVPDEEIGGRAGAEKF
AESDEFQKLNVGIVLDEGLPSPGENYRVFYGERSPWWMVIKAVGAPGHGAKLYDNTALEN
LFKSIESVRRFRASQFDLVKAGLKAEGEVVSVNMVFLKSGTPSPTGFVMNLQPSEAEAGF
DVRLPPTANPESLERRIAEEWAPVSRNMTFEFKQKESIFDKFGKPALTAIDKSNPWWNLL
EEAVRNANGKLGKPEIFPASTDARYFRNLGLPAIGFSPMANTPILLHDHNEFLNQAEYLK
GIEAYESIIKAYASFIAHKPTESFKDEL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaaatatgttaatcttctcctctctgttataaccattttcttgtttctctca
tcatccattgctgatgaagaatcatcgtcttcctccgcgatcatagccaggttccagcaa
taccttcagattaacaccgtccagccgaacccccactactacgaagctgccgatttcatc
atctcccaggccaaatccctcgccctcgaatcccagacaattgaattcgtggagggcaag
cctctgatcctcctcaaatggcctggttcgaaccccgatctctcttcgatcctcctcaat
tcgcacaccgacgtcgttcctgccgagcaccacaagtggacgcaccctcctctcggagct
cacatcgattccctcggcaatatctacgccagagggtcccaggatatgaagtgcgttggg
atgcagtacctcgaggctattcggcgtttgaaggctttgggattcgagcctgcgcgctct
gtttacctatctttcgtcccggatgaagaaattggtggccgtgctggcgctgagaagttt
gctgaatccgatgagtttcagaaattgaatgtaggcattgtgctcgatgaagggttgcct
tctccgggtgagaactacagggtattttatggggagaggagtccctggtggatggtgatc
aaggcagtgggggcgccaggccatggagcaaagctgtatgataacactgccttggagaat
ctgttcaaaagcattgagagtgtgcggaggttcagggcttctcagtttgatctggtgaag
gccggtctgaaggctgaaggagaggtcgtctctgtaaacatggtcttcttaaaatctggc
actccatctcctactggttttgtcatgaatctgcagccatctgaagctgaggctggtttt
gatgttcgcctcccaccgactgcaaatccagaatctcttgaaagacgaattgcagaggaa
tgggcacctgtttctcgtaatatgacattcgagtttaagcagaaggaatctattttcgac
aagtttgggaaaccagctcttactgcaattgacaaatctaacccttggtggaatcttctc
gaagaagctgttagaaatgccaatgggaaactcggaaagccagaaatctttcccgcttca
actgatgctcggtactttcgaaatctgggcctccctgcaattggcttctctccaatggcc
aacactcctattcttcttcatgaccataatgagtttctgaaccaagctgagtatttgaaa
ggcattgaggcgtacgagtcaataatcaaggcttatgcttctttcatcgctcataaaccg
accgaaagcttcaaagacgagctgtaa

DBGET integrated database retrieval system