KEGG   Momordica charantia (bitter melon): 111011866Help
Entry
111011866         CDS       T05045                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00250  Alanine, aspartate and glutamate metabolism
mcha00410  beta-Alanine metabolism
mcha00430  Taurine and hypotaurine metabolism
mcha00650  Butanoate metabolism
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111011866
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111011866
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111011866
   00430 Taurine and hypotaurine metabolism
    111011866
Enzymes [BR:mcha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     111011866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 111011866
NCBI-ProteinID: XP_022141496
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MVLSKTASQTDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESETAVG
VGTVGSSEAIMLAGLAFKRKWQNRMKAEGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVELVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYQNVMENCRENMIVLKEGLES
TGRFNIVSKDDGVPLVAFSLKDNSRHTEFEVSEMLRRFGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVKDVEKVLHELDSLPSRADFKTTVAGEETQKNDVVVAKKSALETQRE
ITTVWRKFVMEKKKTNGVC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaagactgcctctcagaccgacgtctccgtccactccaccttcgcttct
cgctatgtccgcacctctctcccgagattcaaaatgccggaaaattcgattccgaaggag
gccgcgtaccagatcatcaacgacgaactcatgctcgatggaaaccctaggctcaacttg
gcctcctttgtcaccacttggatggagcctgagtgcgataaactcatcatggccgccatt
aacaagaattacgtcgatatggatgagtatcctgtcactacagaactccagaaccgatgt
gtgaacatgatagcacacttgttcaatgccccactgggagagtcagagacggcggtggga
gtggggactgtgggatcgtcggaggccataatgttggctggtttggctttcaagagaaag
tggcagaacagaatgaaggctgaaggcaagccttgtgacaagcccaacattgtcactgga
gctaatgtccaggtatgctgggagaaatttgcaaggtattttgaggtagagctgaaggag
gtgaaactgagggaaggttactatgtgatggacccagagaaagctgtggagttggtcgac
gagaacaccatctgtgttgcagccatcttgggttccaccctcaatggagaattcgaagac
gttaagctcttaaacgatctcttagtcgaaaagaacaaggaaactggatgggacactcca
atccatgttgatgctgcaagcggagggttcattgccccattcatataccctgagctggag
tgggacttcaggctaccattagtaaagagcattaacgtgagtgggcacaaatatgggctc
gtttatgctggaatcggttgggtcatctggaggaacaaagaagacttgcctgaagaactc
atcttccacatcaactatctcggagctgaccagcccactttcacactcaatttctcaaag
ggttccagccaagtgattgcccagtactaccaattgatccgcttgggctatgagggatac
caaaacgtgatggagaactgccgggagaacatgatagtgctgaaggaggggctggagagc
acagggcggttcaacatagtgtcaaaggacgacggggttccgctggtggcgttctctctg
aaggacaactcgcggcacacggaattcgaggtgtcggagatgctgaggagattcgggtgg
atcgtgccggcgtacacgatgccgccggacgcgcagcacataacggtgctgagagtggtg
ataagagaggacttttctcgaacacttgctgagcgtctggtgaaggacgtggagaaagtg
ctgcacgagctggacagcctgccgtcgagggcggacttcaagacgacggtcgccggagaa
gagacgcagaagaacgacgtcgttgtggccaagaagagcgctctcgagacgcagagggag
atcaccacggtttggaggaagttcgtcatggagaagaagaagaccaatggagtttgctag

DBGET integrated database retrieval system