KEGG   Momordica charantia (bitter melon): 111012527Help
Entry
111012527         CDS       T05045                                 

Definition
(RefSeq) thymidine kinase a-like
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00240  Pyrimidine metabolism
mcha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    111012527
Enzymes [BR:mcha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     111012527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 cobW AAA_24
Motif
Other DBs
NCBI-GeneID: 111012527
NCBI-ProteinID: XP_022142380
LinkDB All DBs
Position
Unknown
AA seq 292 aa AA seqDB search
MSMSTISRMKPFVSSSSSFSTLFPGIPITTPPPFFSLLSKPTHCRPIFSQPVNFFTFKTP
TISLPINGVFSTQNRTGPIGASSSPPSGEVHVIVGPMFAGKTTTLLRRIQSESSDGRSVA
IIKSNKDTRYGLDSIVTHDGMKLPCWALPNLSSFKQKFGQGAYDKLDVIGIDEAQFFDDL
YDFCREAADIDGKTIIVSGLDGDYLRRSFGSVLDIIPLADSVTKLTARCEICGNRAFFTL
RKTEEKETELIGGADVYMPVCRRHYVSGQVAIEAARTVIESHQDKVECGNPA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgtcaactatttccaggatgaaacccttcgtatcttcttcctcctctttctca
acccttttccccggtatccccattaccactcctccgcccttcttttctctgctttctaaa
cccacccattgcaggcctattttctcccaacccgtcaattttttcactttcaaaacaccc
acaatttcgctgcccataaacggggttttctcaacccagaatcggaccgggccaatcgga
gcttcttcgtcacccccctccggcgaggtccacgtaatagtcgggcccatgttcgccggg
aaaaccaccactcttcttcgccggattcagtccgagagcagtgatggcagaagtgtagct
ataattaagtcgaataaggacacaagatacggattggattcgattgtcacgcatgatggc
atgaaactgccttgctgggcattaccaaacttgtcatctttcaaacaaaaatttgggcaa
ggtgcttatgacaagctagacgtgatcggtattgatgaagctcaattctttgacgatctt
tacgatttctgtcgggaagctgctgatattgatggcaaaacaattatagtttctgggctg
gatggggattacttgaggaggagcttcggttcggttctcgacataattccactagctgat
tctgtaacaaaactaactgctcgatgcgagatctgtgggaatcgagctttctttacctta
aggaagacagaagaaaaagagactgagctgatcggtggtgcagatgtgtacatgcctgtg
tgtcgacgacattacgtcagcgggcaagtagcgatcgaggcagcaagaactgtgattgaa
tcacaccaggacaaggttgagtgtgggaatccagcatag

DBGET integrated database retrieval system