KEGG   Momordica charantia (bitter melon): 111012738Help
Entry
111012738         CDS       T05045                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00052  Galactose metabolism
mcha00500  Starch and sucrose metabolism
mcha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111012738
   00500 Starch and sucrose metabolism
    111012738
Enzymes [BR:mcha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     111012738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 111012738
NCBI-ProteinID: XP_022142682
LinkDB All DBs
Position
Unknown
AA seq 926 aa AA seqDB search
MEWKTLQIGDELLWRLRKMEDVDRRRMQRTATRATSGLSFFILICFFFLCLAQPPPPPPA
GHGYRIRSVQLHPTGKSLTADLALIGTSSSVYGPDLPTLTLQASFETKDRLRIRITDSAR
ERWEIPDNIIPRRSNSRFRSLPESHVDSPATAFISDPASDLAFSLRNTTPFGFSVLRRSS
GDVLFDTAPDLSDPGTFLVFKDQYIQLSSLLPNDRSSLFGIGEQTRESFKLVSNKSKTLT
LWNADIGRAIVDVNLYGSHPFYIDVRSPSRDGKVVAGTTHGVLLLNSNGMDIIYSGDRIT
YKVIGGVIDLYFFAGPSPVSVIDQYTELIGRPAPVPYWSFGFHQCRYGYKNVSDVENVVA
RYAKAGIPLEVMWTDIDYMDGYKDFTFDPINFPAEKMKIFVDNLHQNGQKYVAILDPGIS
INKTYGTFIRGTKADIFIKYNGVPYSGEVWSGPVYFPDFVHPNSEIFWGGEIKLFRDIVP
FDGLWIDMNEISNAITSSTSPLSNLDNPPYKINNAAVLRPINNNTVPASSLHFGNLTEYN
THNLYGLLESRATHASLVKVTGKRPFVVSRSTFVGSGKYTAHWTGDNDATWNDLGYTIPS
ILNFGLFGIPMVGSDICGFAGDTTEELCRRWIQLGAFYPFARGHSDKFYIRRELYLWDSV
AATARKVLALRYRLLPYFYTLMYEAHRKGTPIARPLFFSFPQDIKTYEISSQFLLGKGVL
ISPVLKEGALSVDAYFPEGNWFSLFNYSESVSVKSGQQVTLDAPADHINVHVREGNILVL
HGDAMTTRAARGTAFKLLVVVSNGQSSDGEVFLDDGGVVEMGEEGGNWSLVRFHSEAVGS
KLLIKSEVVNGGFALTQKLIIDKVTFIGFERHEKMGGFGLKISKGANLNGNSAIKKTYEY
SGKFVNVEISALSIPIWEEFKLELTF
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggagtggaaaacccttcaaattggagatgaactgctctggcgactgagaaaaatggag
gacgtcgaccggagacgaatgcagagaactgcaaccagagccacgtctggactctctttt
ttcattttaatttgcttcttcttcctctgtctcgctcaacctccgccgccgccccccgcc
ggacatggctaccggatcagatcggtgcaacttcatcccaccggaaagtcgttgaccgcc
gatctcgccctcatcggaacttcttcctccgtttatggacccgatcttcccacactcacc
ctccaagccagtttcgagacgaaagaccggctgagaatacgaataacagactcagcscgc
gaaagatgggagattccggacaacataattccccgccgatccaactcccgattccgttcc
ctgccggagagccacgtcgactcgccggcgaccgctttcatctccgatcccgcttccgac
ctcgctttcagcctccgcaacaccacgcctttcggtttttccgtgcttcgacggtcgtcc
ggcgatgtcctcttcgacacggctccggatttgtcagatccggggacttttctcgtcttc
aaggatcaatacattcaactctcctccttgcttcccaacgatagatcctctctgttcggc
attggcgagcaaaccagggaatcgttcaagctcgtgtcgaataaaagcaaaaccctaacg
ctttggaacgccgatatcggcagggccatcgttgatgtgaacctatacggttcgcatcct
ttctacattgacgtccggtcgccgtctcgcgatggwaaagtagtggcggggacgacgcac
ggagttctgttgctgaacagtaatggcatggatattatatactctggcgataggattacg
tacaaggttatcggtggagtcatcgatttgtacttctttgcgggtccgtcgccagtatcg
gtgatagatcagtatactgagcttattgggcggcctgcacccgtgccttactggtcattt
ggatttcaccaatgtcgttatggctacaagaatgtttctgacgttgagaatgttgttgct
cgttatgccaaagccggtattcctcttgaagttatgtggacagacattgattacatggat
gggtataaggattttacttttgatcccatcaattttccagcggagaagatgaagatattt
gttgataatcttcaccaaaatggacaaaaatatgtggccatcttggatcccggtatcagt
ataaataagacatatggaacattcattcgaggaacaaaagctgacatctttataaaatac
aatggggtcccatactcaggcgaggtttggtctggacctgtttacttccctgattttgtt
catccaaacagtgagatattttggggtggcgagattaaattatttcgagatattgttcca
tttgatggtctttggattgatatgaatgagatatcaaatgctataacttcttctacaagc
ccactttctaaccttgataaccctccttacaagattaacaatgctgcagtactacgtccc
attaacaataatactgtgccagcatcaagtcttcattttggtaacttgacagagtataat
actcataacttatatggtctcctagagtcaagggctactcatgcctctttagtgaaagta
acgggcaaaagaccttttgttgtgtcaagatcaacttttgtaggctctgggaagtacacg
gcacattggactggagataatgatgcaacatggaatgatttaggatacacaatcccatcc
attttgaactttgggctctttggaattccaatggttggttctgacatctgtggatttgct
ggagacacgaccgaagaactttgtcgacgttggattcagttaggtgcattttaccctttt
gccagaggtcattctgataaattctacattcgtcgagagctctatctttgggattcagtc
gctgcaacagccaggaaggtccttgcacttcgttatcgcctacttccttacttctacact
ttgatgtatgaggcacatagaaagggaacacccattgcacgtcctctcttcttctcattc
cctcaggatatcaagacctatgaaatcagctcccagtttctacttggcaaaggtgtattg
atttccccagttttgaaggagggagctctttctgttgatgcatatttcccggaaggaaac
tggtttagcctcttcaattattcggagtcggtgagtgtaaagtcagggcagcaagtcact
cttgatgcacctgctgatcatataaacgtccatgtcagggaaggaaatattttagtatta
catggggatgcgatgacaacacgagcagctcgaggaaccgccttcaagcttttggtagtc
gtcagcaatggtcagagcagcgatggagaggttttcttggatgatggaggagtggtggaa
atgggagaagagggagggaattggagcctggtaagatttcatagtgaagcagttgggagt
aagttactgatcaaatctgaggttgtaaatggaggatttgctttgacccaaaaactgata
attgacaaggtgacctttatagggtttgaaaggcatgagaaaatgggtgggtttggttta
aagataagcaaaggagcaaacttgaatggaaactcagccatcaaaaagacgtatgagtac
tctggcaagtttgttaatgttgaaatctcggcactgtcaattcctatttgggaagaattc
aaattggagttgacattttaa

DBGET integrated database retrieval system