KEGG   Momordica charantia (bitter melon): 111016801Help
Entry
111016801         CDS       T05045                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00620  Pyruvate metabolism
mcha00710  Carbon fixation in photosynthetic organisms
mcha01100  Metabolic pathways
mcha01200  Carbon metabolism
Module
mcha_M00168  CAM (Crassulacean acid metabolism), dark
mcha_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
mcha_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
mcha_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111016801
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111016801
Enzymes [BR:mcha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     111016801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 111016801
NCBI-ProteinID: XP_022148015
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MAAPKNLEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQE
CYEFSAEYERKHDPRKLEELGNALTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRI
KLKKGGFADEANATTESDIEETFKRLLQLNKSPQEVFDALKNQTVDLVFTAHPTQSVRRS
LLQKHARIRNCLTQLYANDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCSNELQSRAEELHRSSRKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYNTRERARHLLTSGISEIPEDSTFTDVEQFLEPLELCYRSLCAC
GDRSIADGSLLDFLRQVSTFGLSLVRLDIRQESERHADVIDAITNYLDIGSYKEWSEEQK
QEWLLSELSGKRPLFGPDLPKTEEIADVLDTFNVIAELPSDNFGAYIISMATAPSDVLAV
ELLQRESHVRKPLRVVPLFEKLADLEAAPSAMARLFSIDWYRNRIDGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELINVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPISPKPEWRALMDAMAVVATE
KYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKCIIEKDVKNLHMLQQMYRQWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEDLWSFGERLRANYEETKDLLLQVAKHKDLLEGDPYLRQRLRLRDSYITTLNVCQA
YTLKRIRDPNYNVKVRPHLSKEYLESSKPAAELVKLNPKSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccaagaacttggagaaaatggcttccattgatgctcaattgagacttctt
gcaccgagtaaggtgtcggaggatgataagctggtggaatatgatgctttgttgctcgat
cgctttctggatattcttcaggatttgcacggggaggatctcagagaaactgttcaagag
tgctatgaattctcagccgagtatgagaggaagcacgaccctcggaaattagaggaactt
gggaatgccttaacgagtttggatcctggggattctattgttgttgcaaaatccttttcc
catatgcttaatttagccaatttggccgaggaagttcagattgcctatcggaggaggata
aagttaaagaaaggtggctttgctgatgaggccaatgctacaactgagtcagatattgaa
gaaaccttcaagaggcttctgcagttgaacaagtctcctcaagaagtatttgatgcttta
aaaaatcagactgtggatttggtctttacagcccatcctactcagtctgtccgcagatct
ttgcttcaaaagcatgccaggataagaaattgcttgacgcagttgtatgcaaacgacatt
actcctgatgacaagcaggaacttgatgaagctctgcaacgggagattcaagctgcattt
cgtaccgatgaaatccgacgaacacctccaacaccacaagatgagatgagagctggaatg
agctacttccacgagacaatctggaaaggtgtacctaaattcttgcgtcgagtggatact
gccttgaagaacatcggaattgatgaacgcgttccttataatgctcctcttattcagttt
tcatcctggatgggtggggatcgcgatggaaaccccagggttacaccagaagtaacaagg
gatgtctgcttattggctagaatgatggctgctaacttgtatttttcccagatagaggat
cttatgtttgagttatctatgtggagatgcagtaatgaattacagagtcgggctgaagaa
cttcatcggtcctcaagaaaagatgcaaagcactacatagagttttggaaacaaattcct
ccaaatgagccctaccgtgttattcttggggatgtacgagacaagttatataatacacgt
gagcgtgctcgtcacttattaaccagtggaatctctgaaattcccgaagattctactttc
actgatgttgagcagttcctggagcccctcgagctctgctacaggtcactctgcgcttgt
ggcgataggtcaattgctgatgggagccttctagatttcttacggcaagtttctacattt
gggctttcacttgtcagactggatatccgacaagaatcagaaaggcacgctgatgtcatt
gatgctatcactaactacttggacattggttcatacaaagaatggtccgaagaacaaaaa
caagaatggctactatccgaactcagtggaaaacgccctctttttggtcctgatcttcca
aagaccgaagaaattgctgatgttctggacaccttcaatgtcattgcagagcttccttca
gataactttggtgcttatattatctcaatggcaacagctccatctgacgtgcttgctgtt
gagcttttacagcgtgaaagtcatgtgaggaagccactgagggttgtcccattatttgaa
aaacttgctgatcttgaggctgctccttctgctatggctcgtctcttttcaatcgattgg
tatagaaaccgcattgatggtaagcaagaagtcatgatcgggtactcagattcaggaaag
gatgctggtcgtctctctgctgcatggcagctttataaggcccaagaagaactcatcaat
gtggctaaacaatatggagttaagcttacaatgtttcatggccgaggaggaacagttggt
aggggagggggtcctacccaccttgctatattatctcagccccctgatacaatccacggt
tcactacgtgtcacagttcaaggcgaggtcattgaacaatcttttggagaagagcacttg
tgctttagaacacttcagcgttttactgctgcaacgcttgaacacggcatgaatccacct
atttctccaaagccagagtggcgtgctctcatggatgctatggcagttgttgctaccgaa
aaatatcgctccattgttttccaggaacctcgttttgttgaatacttccgcctcgcaact
ccagagttagaatatggtcgaatgaatattggaagtcgtccatcaaagaggaagccragt
ggaggcatcgaatcactgcgtgcaattccatggatctttgcttggacacaaacaaggttt
catctaccagtttggcttggttttggagcagcatttaaatgtataattgagaaggatgtg
aagaatctccatatgctgcaacagatgtaccgtcagtggcctttctttagagtcactatt
gacttagttgaaatggtgtttgccaaaggagacccaggaattgctgctctgtatgacaag
cttctcgtgtcagaagatctatggtcgttcggagagcggttgagagctaactatgaagaa
actaaggaccttctccttcaggtagctaagcacaaggatcttctcgaaggagacccttac
ttgaggcagcgactccgtcttcgtgattcatacataaccacccttaacgtttgccaagca
tatacattgaagcggatccgtgatcccaactacaacgtgaaagtcaggcctcacctctca
aaggaataccttgaatcaagcaaacctgctgcagaacttgtgaagctcaacccgaagagc
gagtacgcacctggtttggaagacactcttatcctaacgatgaagggtatcgctgccggt
atgcagaacaccggttaa

KEGG   Momordica charantia (bitter melon): 111016802Help
Entry
111016802         CDS       T05045                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00620  Pyruvate metabolism
mcha00710  Carbon fixation in photosynthetic organisms
mcha01100  Metabolic pathways
mcha01200  Carbon metabolism
Module
mcha_M00168  CAM (Crassulacean acid metabolism), dark
mcha_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
mcha_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
mcha_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111016802
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111016802
Enzymes [BR:mcha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     111016802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 WbqC
Motif
Other DBs
NCBI-GeneID: 111016802
NCBI-ProteinID: XP_022148016
LinkDB All DBs
Position
Unknown
AA seq 637 aa AA seqDB search
MALIGLIFIIISSLTLSGFTHFLGAEFWKQIPPNEPYRVILGDVRDKLYNTRERARHLLT
SGISDIPENSTFTDVEQFLEPLELCYRSLCACGDRSIADGSLLDFLRQVSTFGLSLVRLD
IRQESERHXDVIDAITNYLDIGSYKEWSEEQKQEWLLSELNGKRPLFGPDLPKTEEIADV
LDTFNVIAELPSDNFGAYIISMATAPSDVLAVELLQRECHVRKPLRVVPLFEKLADLEAA
PSAMARLFSIDWYRNRIDGKQEVMIGYSDSGKDAGRLSAAWQLYKAQEELIKVAKQYGVK
LTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLRVTVQGEVIEQSFGEEHLCFRTLQRF
TAATLEHGMNPPISPKPEWRALMDAMAVVATEKYRSIVFQEPRFVEYFRLATPELEYGRM
NIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVWLGFGAAFKYIIEKDVKNLHMLQQ
MYRQWPFFRVTIDLVEMVFAKGDPGIAALYDKLLVSEDLWSFGERLRANYEETKDLLLQV
AKHKNILEGDPYLRQRLRLRDSYITTLNVCQAYTLKRIRDPNYNVKVRPHLSREYLESSK
PAAELVKLNPKSEYAPGLEDTLILTMKGIAAGMQNTG
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggctttgattggactaatatttatcatcataagttcattgaccttgagtggctttaca
cactttctgggtgcagagttttggaaacaaattcctccaaacgaaccttaccgtgttatt
cttggggatgtacgagacaagttatacaacacacgtgagcgtgctcgtcatttattaacc
agtggaatctctgacattcccgaaaattctactttcaccgatgttgagcagttcctggag
cctctcgagctctgctacaggtcactctgtgcttgtggcgatagrtcaattgctgatggg
agccttctagatttcttacggcaagtttcwacatttggrctgtcacttgtgagacttgat
atccggcaagaatcagaaaggcatrctgatgtcatcgatgctatcactaattacttggac
attggwtcatacaaagaatggtccgaagaacaaaaacaagaatggttactatccgaactc
aatggaaaacgccctctttttggccctgatcttccaaagacagaagaaattgctgatgtt
ctggacaccttcaatgtcattgcagagcttccttcagataactttggtgcttatattatc
tcaatggcaacagctccatctgacgtgcttgctgttgagcttttacaacgtgaatgtcat
gtaaggaagccattgagggttgtaccattatttgaaaaacttgctgatcttgaggctgct
ccttctgctatggctcgtctcttttcaatcgactggtacagaaaccgcattgatggtaag
caagaagtcatgattgggtactcagattcaggaaaggacgctggtcgtctctctgctgcg
tggcagctatacaaggcccaagaagaactcattaaagtggctaaacaatatggagtgaag
ctcacaatgttccatggtcgaggaggaacagttggcaggggagggggacctacccacctt
gctatattatctcaacctcccgatacaattcatggttcactacgtgtcacagttcaaggt
gaggtcattgaacaatcttttggagaggagcacctgtgctttagaacacttcaacgtttt
actgctgcaacgcttgaacacggcatgaatccacctatttctccaaagccagagtggcgt
gctctcatggatgctatggcagttgttgctactgaaaaatatcgctccatagttttccag
gaaccccgttttgttgaatacttccgccttgcaactccagagttagaatatggtcgaatg
aatattggaagtcgtccatcaaagaggaagccaagtggaggcatcgaatcactgcgtgca
attccatggatctttgcttggacacagacaaggtttcatctaccagtttggctcggtttt
ggagcagcatttaaatatataattgagaaggatgtgaagaatctccatatgctgcaacag
atgtaccgtcagtggcctttctttagagtcactattgacttagttgaaatggtgtttgcc
aaaggagacccaggaattgctgctctgtatgacaagcttctcgtgtcggaagatctatgg
tcgttcggagagcggttgagggctaactatgaagaaactaaggaccttctccttcaggta
gctaagcacaagaatattctggaaggagacccatacttgaggcagcgactccgtcttcgt
gattcgtacataaccacccttaacgtttgccaagcgtatacattgaagcggatccgtgat
cccaactacaacgtgaaagtcaggcctcacctttcaagggaatatcttgaatcaagcaaa
cctgctgcagaacttgtgaagctcaacccaaagagtgagtatgcgcctggtttggaagac
acccttatcctaacaatgaagggtatcgctgctggtatgcagaacaccggttaa

KEGG   Momordica charantia (bitter melon): 111023897Help
Entry
111023897         CDS       T05045                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 4 isoform X1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00620  Pyruvate metabolism
mcha00710  Carbon fixation in photosynthetic organisms
mcha01100  Metabolic pathways
mcha01200  Carbon metabolism
Module
mcha_M00168  CAM (Crassulacean acid metabolism), dark
mcha_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
mcha_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
mcha_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111023897
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111023897
Enzymes [BR:mcha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     111023897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 111023897
NCBI-ProteinID: XP_022157084
LinkDB All DBs
Position
Unknown
AA seq 1043 aa AA seqDB search
MTDTTDDIAEEISFQSFDDDCKLLGNLLADVLQREVGSQSMEKLERTRVLAQSACNMRMA
GIEDTADMLEKQLASEISKMTLEEALTLARAFSHSLNLMGIAETHHRVRKSRNMASLSRS
CDDVFNQLVQGGVSPEELYDSVCKQEVEIVLTAHPTQINRRTLQYKHLRIARLLDYNDRP
DLSPEDREMLIDDLVREITSIWQTDELRRHKPTPVDEARAGLNIVEQSLWKAVPYYLRRL
SNALKKHTGKSLPLTCTPIKFGSWMGGDRDGNPNVTAKVTRDVSLLSRWMAIDLYIRELD
SLQFELSMNRCSDRLYRLADEILEKEAVSEDRRDTWNQSSLKIESKNQSHQAAALPRQLP
HRADLPSCTDCNDGESRYSRVEFPRTDHTSSNNQETSDPDTRPSLSNGGSPTASAPRSAS
FNSSQLLAQRKLFAESQMGRSSFQKLLEPRLPPRPGLAPYRVVLGSVKDKLVKTRRRQEL
LLEDLPCEQDPSDYYETADQLLEPLLLCYESLQSCGSVVLADGRLVDLIRRVATFGMVLM
KLDLRQESGRHAETLDAITEYLDMGTFSDWDEERKLEFLTRELKGKRPLVPPTIEVASDV
KEVLNTFRVAAELGSESLGAYVISMASNASDVLAVELLQKDARLAVSGELGRPCPGGTLR
VVPLFETVDDLRKAGSSIRKLLSIDWYREHIIKNHNGLQEVMVGYSDSGKDAGRFTAAWE
LYKAQEDVVAACNEYGIKITLFHGRGGSIGRGGGPTYLAIQSQPPGSVMGTLRSTEQGEM
VQAKFGLPQTAVRQLEIYTTAVLLSTLRPPLPPRETKWRNLMEEISKISCENYRSMVYEN
PEFLAYFHEATPQAELGFLNIGSRPTRRKTSVGIGHLRAIPWVFAWTQTRSVLPAWLGVG
AGLKGVCEKGHTQDLESMYQEWPFFQSTLDLIEMVLGKADTHIAKHYDEVLVSENRRELG
SVLRKKLEETEKYVLIVSRHGKLSENNRSLRRLIESRLHYLNPLNLLQVEVLKRLRCDSD
NKKLRDALLITINGIAAGMRNTG
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgacggataccactgacgatatcgccgaggaaatctccttccagagcttcgacgatgac
tgtaaattgcttggcaaccttctcgctgatgtcctgcagcgcgaagttgggagccagtct
atggaaaaacttgaacgaactcgagtcctcgctcagagcgcttgcaacatgaggatggcg
ggcatcgaggatacggcagacatgctcgagaagcagctggcgtcggagatatcgaaaatg
actttagaggaagccctcactctagctcgtgcattcagccattctctcaacctgatgggg
attgcagaaacccaccacagggttcgtaagtcgagaaatatggcatctctatcaagatct
tgcgatgatgtttttaatcagttagtgcagggtggagtttctcctgaagaactttacgac
agcgtttgcaagcaggaggttgaaattgttcttacagcacatccaactcaaataaatcgt
cgtactttgcagtacaaacatctccgcattgctcgtctattggactataatgaccgacct
gatcttagtcctgaagatcgagaaatgctaatcgatgatctggtaagagagataacttca
atatggcagacagatgaacttagacgccacaagcccacaccagttgatgaagctagggct
ggtttaaacattgtggaacagtccctgtggaaagccgtcccttactatttacgtcgactc
agcaatgctttaaagaagcacactggaaagtcacttcctttgacttgcacaccaatcaaa
tttgggtcttggatgggaggcgacagggatggaaatccaaatgtcacagcaaaagtcaca
agagatgtctctcttttgtctaggtggatggctatcgatctctacattcgagagcttgat
agcttgcaatttgaactttccatgaaccgatgcagtgatagattatacagactggcagat
gaaattctcgaaaaagaagctgtatctgaagaccgacgtgatacatggaatcaatcttcg
ctcaaaattgaatcgaagaatcagagccatcaagctgctgcacttccaagacaacttcca
catagggctgatctaccttcatgcacggactgcaatgatggtgaatccagatattctaga
gtagaatttcccaggactgatcatacatcatcaaataatcaggagacctctgatccagat
acacgtccatctttatcgaatggaggttcacctactgcaagtgcacctcgttctgcatct
ttcaactctagtcaactccttgctcagaggaaactgtttgcagaatctcagatggggagg
tccagttttcagaagcttttagaacccaggctccctccacgtcctggacttgcaccctac
cgtgttgtgcttggtagtgtaaaagacaagcttgtgaaaacacgaagaaggcaggagtta
cttctcgaggatcttccttgtgaacaagatccttcagattactatgagactgcagatcaa
ctcttggagccgctgcttctatgctatgagtctctgcaatcatgtggatctgtggtgctt
gctgatggtcggttagttgatctgattagaagagttgctacatttggtatggtattaatg
aagctggatttacgtcaggaatctggtagacatgcggaaactctggacgccattacagag
tacctggacatgggtacatttagtgactgggatgaagaaaggaagttggaatttctaaca
agagagctaaaggggaagcgaccactggttcctccaacaattgaggttgcttctgatgtt
aaagaggttttgaacaccttccgtgttgctgctgagctggggagtgaatcacttggtgcc
tacgtgatctctatggcctccaatgcaagtgacgtactcgcagtggaacttctgcagaaa
gatgcacgacttgctgttagtggagagctaggacggccatgtcctggtggaacgttgcgt
gtggttcctctgtttgaaaccgtggacgacttgaggaaagcaggatcatcgataaggaaa
ctattatctattgattggtatcgagaacacatcataaagaaccataatgggctccaagag
gtgatggtgggttattctgattctggcaaagatgctgggcgcttcactgctgcatgggaa
ctttacaaagctcaagaagatgttgtggctgcatgcaacgagtatggtatcaaaattacc
ctgtttcatgggcgtggagggagcattggccgtgggggtggacctacatatctggccatt
caatcccagcctccaggttcggtaatgggtactctacgatcaaccgagcaaggggaaatg
gtgcaggccaagtttggattgcctcaaactgctgttagacagctagaaatatacacaacg
gctgtactcctttcgaccctacgtccacctcttccacctcgagaaacaaaatggcgtaat
ctcatggaggagatctcgaaaatcagctgcgagaactacaggagcatggtatatgaaaat
ccagaattccttgcttacttccacgaggccactcctcaggcagagcttggcttccttaac
attggaagccgcccaacaaggagaaaaacctccgtcgggatcggacatcttcgagccata
ccatgggttttcgcttggacacaaactagatctgttcttccagcttggcttggggttggg
gcaggtttaaaaggtgtatgtgaaaagggtcacacccaagacttggaatcaatgtaccaa
gaatggcctttcttccagagtaccctagaccttatagagatggttttaggcaaagctgat
actcatattgcaaagcattatgatgaagtcctcgtctccgagaatcggcgcgaactcgga
tctgtactgaggaagaaactggaagagactgagaaatatgttctgatagttagcaggcac
gggaaactatccgagaacaatcggagtttgaggaggctgatcgagagcagactccattat
ctgaatcctctgaacctgcttcaagtggaggtattaaagaggctgagatgtgattcagac
aacaaaaaactcagagatgcattacttattacaatcaatgggatcgcagcaggaatgagg
aacacaggttaa

KEGG   Momordica charantia (bitter melon): 111025911Help
Entry
111025911         CDS       T05045                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00620  Pyruvate metabolism
mcha00710  Carbon fixation in photosynthetic organisms
mcha01100  Metabolic pathways
mcha01200  Carbon metabolism
Module
mcha_M00168  CAM (Crassulacean acid metabolism), dark
mcha_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
mcha_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
mcha_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111025911
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111025911
Enzymes [BR:mcha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     111025911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 E2R135
Motif
Other DBs
NCBI-GeneID: 111025911
NCBI-ProteinID: XP_022159520
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MANRNLEKMASIDAQLRLLVPGRVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC
YEVSAEYEGKRDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADENSATTESDIEETLKKLVGELKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARIRDCLVQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCSSELRERADLLHNSSRRDAKHYIEFWKQVP
ASEPYRVILGDVRDKLYQTRERSRHLLANGYSDIPEDATFTNVEQFLEPLELCYRSLCTC
GDRAIADGTLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLDLGSYKEWSEEQR
QEWLLSELSGKRPLFGPDLPTTEEISDVLNTFHVIAELPADNFGAYIISMATAPSDVLAV
ELLQRECHVKQPLRVVPLFEKLADLEAAPAALARLFSVDWYRDRISGKQEVMIGYSDSGK
DAGRFSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTVHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVVATQ
EYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHIIQKDVRNLHVLQEMYNAWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSKDLWSFGERLRTNFEETKSLLLKIAGHSDLLEGDPYLKQRLRLRNSYITTLNVCQA
YTLKRIRDPNYHVTVRPHISKEIMEASKPADELVQLNPKSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcggaatctggagaagatggcatctatcgatgcgcagcttcggcttttagtc
ccaggcagagtgagtgaggatgataaattggtggagtacgacgcgttgttactggatcga
ttccttgacattctccaggatttacatggggaggatcttaaggaaactgtgcaagaatgt
tatgaagtttccgctgaatatgaggggaagcgcgatccaaagaaacttgaggagctggga
agtgtgctgactagtttagatccaggggactctattgtcattgcaaaatctttctcccat
atgcttaacttggctaacttggccgaggaggttcagattgcctatcgtcggagaatcaaa
ctgaagaagggagattttgctgatgagaactctgcgaccactgaatcggatattgaggaa
actctgaagaagcttgttggcgaactgaagaagtctcctcaagaagtttttgatgccttg
aagaaccagactgttgatttggtcttaactgctcatcctactcaatcagttcgtagatca
ttgcttcagaagcatgcaaggataagggattgtttagtccaattgtacgccaaagacatt
actcctgacgacaagcaagagcttgatgaggcacttcagagagagattcaagctgcattt
cgtacggatgaaattcgtagaactcctcctacaccacaagatgaaatgagggcaggaatg
agctacttccatgagacaatttggaagggtgttcctaaatttctgcgccgtgttgataca
gctttgaaaaacatagggatcaatgaacgcgttccttataatgcaccactaattcagttt
tcttcttggatgggtggtgaccgtgatggtaatcctagagtgacacccgaggtcacaagg
gatgtctgtcttcttgctagaatgatggctgctaatctgtactactcgcagattgaggat
ctcatgtttgagttgtctatgtggcgttgcagtagtgagcttcgtgagcgtgcagacctg
ctccataattcatcaaggagagatgcaaaacactatatagaattttggaagcaagttcct
gccagtgaaccatatcgagtgattcttggtgatgtaagggacaagctttatcaaacacgt
gaacgttctcgccatttgttagcaaatggatattccgacatcccagaggatgcaactttt
acaaatgttgagcagttcttggaacctcttgaactatgctatagatccctctgcacttgt
ggcgaccgtgcaattgctgacggcaccctgcttgatttcttgaggcaagtgtccactttt
ggcctgtcccttgtaagacttgacatcaggcaagagtcagatcgtcacactgatgtcttg
gatgccattacgaagcatttggatcttggttcctacaaagaatggtctgaagaacagcgg
caagaatggcttttatccgaactgagtggcaaacgccctctttttggtcctgatcttcct
acaactgaagaaatatctgacgttttgaacacattccatgtcatagctgaacttcctgcc
gataacttcggtgcatatatcatctccatggccactgctccatctgatgttctggcagtt
gagctcttgcaacgtgagtgccatgttaagcaaccactaagagttgttccactgtttgag
aagcttgcagatttggaggctgcaccggcagctcttgctcgcctcttctcagttgattgg
tacagagatcggattagcggaaagcaagaagtcatgattggctactcggattctggtaaa
gatgcagggcggttctctgcagcctggcaattgtacaaggctcaagaggagcttataaag
gttgccaagcaatatggtgtgaagctaactatgtttcatggtcgtggtggcactgttgga
agaggaggtggcccaacccatcttgctattttgtcccagccacccgatacagttcacggt
tcgctccgtgtgacggtacagggtgaagttattgagcagtcctttggagaggagcacttg
tgctttagaacactccagcgtttcactgcagcaacacttgagcatggaatgcaccctcca
gtttcaccaaaacctgaatggcgtgcacttatggatgaaatggctgtcgttgctacacaa
gaatatcgttccattgtcttcaaagaaccacgatttgtcgaatatttccgccttgcaaca
ccagagctggagtatggtaggatgaacattggaagccgcccatcaaaacgtaagccaagt
ggcggaatcgagtcacttcgtgccataccgtggatctttgcatggacgcagacgaggttt
catctaccggtttggttgggcttcggagctgcattcaagcatatcattcagaaagacgtt
aggaacctccatgtgttgcaggagatgtacaatgcatggcccttctttagggtcaccatt
gatttggttgaaatggtgttcgccaaaggagaccccggaattgctgctttgtacgacaag
ctcctagtttcaaaggacctctggtctttcggagagcgcttgagaaccaactttgaagaa
acaaagagccttcttctcaagattgctggacacagcgaccttcttgaaggcgatccttac
ttgaagcaaagactccgtctccgtaactcgtacatcacgactctgaatgtgtgccaagca
tacacattgaaacgaatccgtgacccgaactaccatgtgacagtgcgtccacacatttca
aaggagataatggaagcaagcaaaccagcagacgaacttgttcaactaaacccgaagagc
gagtacgcacccgggttagaggacaccctgatcttgaccatgaagggtattgctgctgga
atgcagaacactggttaa

DBGET integrated database retrieval system