KEGG   Momordica charantia (bitter melon): 111017888Help
Entry
111017888         CDS       T05045                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111017888
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcha03036]
    111017888
Enzymes [BR:mcha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111017888
Chromosome and associated proteins [BR:mcha03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111017888
   Polycomb group proteins
    PRC2-EZH2 complex
     111017888
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 111017888
NCBI-ProteinID: XP_022149468
LinkDB All DBs
Position
Unknown
AA seq 924 aa AA seqDB search
MESKDSLPSPSADRSDLQDDPLTMKPQGQDSASKEILSVIDFLKKQVAGERCNSVQKRME
ENKQKLVGITTHLLKSSTERRIRRVNDSDKGVDLLTKRQKDALDMQNGIDVSDGENDRSQ
EDSHASTAVLLGSNVAVRNAVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIY
YDQSGGEALICSDSEEEVMEDEEEKRDFVESEDYILRMTMKEIGSTDLVLESLSHCFSRS
PGEIKARYEVLNQGEKAIGCFNNKINEEISHIGSSFLDKDLDAALDSFDNLFCRRCLVFD
CRLHGCSQDLVFPAEKQPKWGHVDEENAPCGPLCYRSVLKSDKNITGGSPLRSDLEEKHP
MSSDGTVAQISSKKKSSCKAARRRAKSYQSESASSNAKNISESSESENGPRQDGNTIHQS
PPPNFKISGVSGIRKRNSKRVAERVLICMQKRQKKMAASESESLASVGHFPSDVKLKSSS
CKENDDTSSSSRKNIRSPTPGRSRRRESLTQQHNKFEQNETLNNSSNEIITNLPADSCDD
YLRKEECVDENLCRQDLADDKSWKAIEKGLFEKGIEIFGRSSCLIARNLLNGMKTCWEVF
QYMNYSENKNCSQVGDGSNSHLEGYAKGSNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSI
RKRITERKDQPCRQYNPCNCQTACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQ
CRSRQCPCFAADRECDPDVCRNCWVSCGDGSLGVPNQRGDNYECRNMKLLLKQQQRVLLG
RSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDA
YRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWA
RKPEASGSKKDDGAPSSGRAKKLA
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgaaggattctttgccttcaccttcggccgacagatcggacctgcaggatgac
ccactgacaatgaaaccacaaggacaagattctgcttctaaggagatcctatcagtcatt
gattttctaaagaagcaggttgctggtgaacgttgcaactccgtacagaaaagaatggaa
gaaaacaagcagaagttggttggcatcaccactcacttgttgaaatcatcaacagaaaga
aggataagaagggtcaatgattcagataagggggtggacctattaacgaagaggcagaaa
gacgcacttgatatgcagaatggcatagatgtaagtgatggggaaaatgaccgatctcag
gaagatagccatgcatctactgcagttcttcttggatctaatgttgcggttagaaatgct
gtacgacctattaagcttcctgaagtaaaaagattacctccttatactacatggatattt
ttggacagaaaccagagaatgactgaagatcaatctgtggttggtcggaggagaatttac
tatgatcaaagtggaggagaagcccttatatgcagtgacagtgaggaagaagtgatggag
gatgaagaggaaaaaagagattttgtagaatctgaagactatatacttcgcatgactatg
aaagaaattggttcaactgatctggtgctagagtcactttctcattgtttctctagaagt
cctggtgaaataaaggcaagatatgaagtgcttaaccagggagaaaaggctatagggtgt
tttaataataagatcaatgaggagatctcacatattggaagttcttttcttgataaagat
ctcgatgcagctcttgattcctttgacaatctattttgtcgtcgttgccttgtttttgat
tgtagactgcatggttgttcccaggatcttgtatttcctgctgagaaacaacctaaatgg
ggccatgtagatgaggaaaatgcaccttgtggcccactctgctatcgatcagtacttaaa
tcagacaaaaatattacagggggttctccacttcgcagtgacttggaagaaaaacatccc
atgtcatctgatggcactgttgctcaaatctcgtcaaagaagaaatcttcttgtaaagct
gctcgaagaagggcaaaatcctatcaaagtgaaagtgcctcatcaaatgcaaagaacata
tcagaaagcagcgagtcagagaatggacctaggcaggacgggaacactattcatcaatca
ccgccaccaaattttaagatatcgggagtgagtggaattcgtaaaaggaacagcaaacgt
gttgctgagcgtgttctcatttgcatgcagaaaaggcagaagaaaatggctgcttccgag
tcagaatctctagccagtgtaggtcattttccaagtgatgtgaaattaaaatctagttca
tgcaaagaaaatgacgatactagttcttcttcacgtaagaatattagatctcctacaccg
ggaaggtctaggaggagggaatccctgactcagcaacacaacaaatttgagcagaatgaa
acactcaataattcatcaaatgagataattactaatctaccggctgatagttgtgatgac
tacttgaggaaggaagagtgtgtggatgaaaatttgtgcaggcaggatttggcggatgat
aaatcttggaaagctattgagaaaggtcttttcgagaagggtattgagatttttggtagg
agcagctgcttaattgcaaggaatttactaaatgggatgaagacctgttgggaagttttt
caatacatgaattattctgagaacaagaattgcagccaagtgggtgacggatcaaattct
catcttgaaggttacgccaagggtagtaatgaggtgagaagaagatcaaggttcttacgt
agaagaggtcgagttcgtcgactgaaatatacttggaaatcggctgcttaccattcaatt
cggaagcgaataactgaaaggaaagatcagccatgcagacagtataatccatgtaattgc
caaactgcttgtggaaagcagtgtgcctgtcttttaaatggcacctgctgtgagaagtac
tgtgggtgccctaagagttgcaaaaaccgttttagaggctgtcattgtgctaaaagtcaa
tgtcgtagtcgtcaatgtccttgctttgcagcagatagagaatgtgatcctgacgtttgt
aggaattgttgggtcagctgtggcgatggtagtcttggggttcccaaccaaagaggtgat
aactatgagtgcaggaacatgaagcttcttcttaaacaacaacaaagagttttactcgga
agatccgatgtatctggttggggagcatttttaaagaatagtgttggaaaacacgaatat
cttggcgagtacactggagagttaatttcacatagggaagcagataaacgaggaaaaata
tatgaccgcgaaaactcatcctttctgttcaatttgaatgaccagtttgttcttgacgca
taccgaaagggcgataaattaaaatttgccaatcattctccagatccaaactgctatgcc
aaggtcatcatggttgctggagatcaccgggttggcatctttgccaaggaaagaattagt
gctggtgaggaactattctatgactatagatatgagcctgaccgagccccggcttgggca
aggaagcctgaggcatcggggtcgaaaaaagacgatggtgctccatcgagcggccgagca
aagaaactcgcttag

DBGET integrated database retrieval system