KEGG   Momordica charantia (bitter melon): 111018660Help
Entry
111018660         CDS       T05045                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00010  Glycolysis / Gluconeogenesis
mcha00020  Citrate cycle (TCA cycle)
mcha00620  Pyruvate metabolism
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
mcha01200  Carbon metabolism
Module
mcha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111018660
   00020 Citrate cycle (TCA cycle)
    111018660
   00620 Pyruvate metabolism
    111018660
Enzymes [BR:mcha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     111018660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 111018660
NCBI-ProteinID: XP_022150542
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MASPFLSRVALSSNTTASFSFSSSVSPVLPWNSSRSYTSFPAKSRRRIPVVQSKIREIFM
PALSSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETA
PVGAPIGLLAETEEEVAEAKAKAASKSASSPAPAVISPSPPPPTSSPAPAISQPSPPPPK
PVSDGPGKIVATPQAKKLAKQHKVDIASITGTGPFGRITPADVEAAAGIVPSKPVVSNVA
SSPVAPVTTAAPSKTAAAPSNLPPPVPGSTVVPFTTMQAVVSKNMVESLSVPTFRVGYPV
TTDALDALYEKVKPKGVTMTALLAKAAAMALAQHSVVNASCKDGKSFTYNDNVNIAVAVA
INGGLITPVLQDADKLDLYLLSQKWKELVEKARAKQLQPHEYNSGTFTLSNLGMFGVDRF
DAILPPGQGAIMAVGASKPTVVTDADGFFSVKSKMLVNVTADHRIVYGAELAAFLQTFAK
IVENPESLTL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccgttcctctctcgcgttgctctttccagcaataccactgcttcattttcc
ttctcttcctccgtctctcctgtcctcccatggaactcctctcgctcatacacctcgttt
cccgctaaatcccgccggaggatcccagtcgtccaatctaagatccgtgagattttcatg
cccgcactcagttccaccatgactgagggcaagatcgtttcgtgggtcaaatccgaaggg
gacgtcctctccaaaggcgagagcgtcgttgtcgtggagtctgataaagccgacatggat
gtggagactttctatgatggaattctcgccgccatcgttgttggagagggcgaaactgct
cctgttggagctccgattggtttattggccgagactgaagaggaagtcgccgaggccaag
gccaaagccgcatctaaatccgcttcttctccggctcctgctgttatttctccctctcct
ccgcctcccacttccagtcctgctcccgcaatttctcagccatcgcctccgccgcccaag
ccagtgtcagatggaccggggaagattgtggcgactcctcaggcgaagaagttagcgaaa
cagcacaaggtggatattgcatcgataactggtactggaccattcggtcggattactccg
gctgatgtggaggccgcagcaggaattgtcccttcgaagcctgttgtaagcaatgtagct
tcttcacctgtggctccagtgactaccgctgccccatctaaaactgctgcagctccttcc
aacttgccacccccagttccaggctcaacggttgtgccattcacgacgatgcaggcggtg
gtgtctaagaacatggtggaaagcctctccgttcctacattccgagttggttatccggtg
accactgatgctcttgatgcgctctatgagaaggtgaaaccaaagggcgtcacaatgact
gccctcttggccaaggctgctgcaatggccctcgctcagcattcggttgtaaatgcaagc
tgtaaagacgggaagagctttacatataacgacaatgtaaatattgcagtagccgtggct
atcaatggtgggttgataacgcctgttcttcaggatgcagataagttggacctctacctt
ctgtctcaaaaatggaaagagttggtcgagaaagctagagccaagcagcttcagccgcat
gaatacaattcaggaactttcacgctctccaatctgggcatgtttggagtggacaggttt
gatgctatacttcctcctggccagggggccatcatggccgttggagcatcgaaaccaact
gttgtcactgacgccgatggctttttcagcgtgaagagtaaaatgttggtgaatgtgact
gctgatcaccgaatagtttacggtgctgagctggctgccttccttcagaccttcgcaaag
atagttgagaatccagaaagcctgaccttgtag

DBGET integrated database retrieval system