KEGG   Momordica charantia (bitter melon): 111021478Help
Entry
111021478         CDS       T05045                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00020  Citrate cycle (TCA cycle)
mcha00190  Oxidative phosphorylation
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
mcha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111021478
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111021478
Enzymes [BR:mcha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111021478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 111021478
NCBI-ProteinID: XP_022154158
LinkDB All DBs
Position
Unknown
AA seq 277 aa AA seqDB search
MATGMLRRTISRVSATPFSRFVRIRAHASEAQAQQVEQKAAAASNLKTFAIYRWNPDSPS
KPELQEYKIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACL
TKIPSGASSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSAPSVPGKEILQSKKD
RAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEAIND
EFKLYRCHTILNCARACPKGLNPGKQIQNIKHLQLVG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagggatgctgaggaggacaatatctagggtttctgcaacgccattttcaaga
ttcgtacgaattcgagctcacgcttccgaggcccaagcccagcaagtggagcagaaggcg
gctgcggcgtcgaatctgaagacgttcgcaatctaccgctggaatcccgatagcccttcc
aaaccagagcttcaggagtacaagatcgatctcaaggagtgcggccccatggtgctggac
gcgctgatcaaaatcaagaacgagatcgatccgtccctcactttccgtcgctcctgccgg
gaggggatctgcggctcctgcgcgatgaacatcgatggatgtaatggcttggcttgcttg
accaagattccgtcgggagcttcatcgacgattacgccgctgccccatatgttcgtgatc
aaggatctggtggtggacatgacgaatttctataaccagtataagagtattgagccgtgg
ttgaagaggaagagcgcgccgtctgtgccggggaaggagattcttcagagtaagaaagat
agggcaaagttggatgggatgtatgagtgcatattgtgtgcttgctgtagtacatcgtgc
cccagctattggtggaaccckgagtcttatcttggaccagccgctttgctccatgccaat
aggtggataagtgatagccgtgatgaatataccaaggagcgacttgaggcaataaatgac
gaattcaagctctaccgttgtcatactattctgaactgtgcccgtgcctgtccaaaaggt
ttgaaccccggaaaacagatccaaaatatcaaacaccttcagctcgtgggttga

DBGET integrated database retrieval system