KEGG   Momordica charantia (bitter melon): 111021872Help
Entry
111021872         CDS       T05045                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00010  Glycolysis / Gluconeogenesis
mcha00051  Fructose and mannose metabolism
mcha00052  Galactose metabolism
mcha00500  Starch and sucrose metabolism
mcha00520  Amino sugar and nucleotide sugar metabolism
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
mcha01200  Carbon metabolism
Module
mcha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111021872
   00051 Fructose and mannose metabolism
    111021872
   00052 Galactose metabolism
    111021872
   00500 Starch and sucrose metabolism
    111021872
   00520 Amino sugar and nucleotide sugar metabolism
    111021872
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111021872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcha04131]
    111021872
Enzymes [BR:mcha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     111021872
Membrane trafficking [BR:mcha04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    111021872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 111021872
NCBI-ProteinID: XP_022154668
LinkDB All DBs
Position
Unknown
AA seq 504 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMRNSGKWARAMVILREFEEKCGTPIGKLRQVAD
AMAVEMHAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDNR
VVKQEFEEVSIPPHLMTGSSEALFDFIAQALAKFVAEEGEGFHPAPGRQRELGFTFSFPV
RQTSISSGTLIKWTKGFNIEDTVGEDVVGELTKAMERLKLDMRVTALVNDTIGTLAGGRY
YNNDVIAAVILGTGTNAAYVERVHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDH
ALDVESLNPGEQIFEKMISGMYLGEIVRRVLFKMADEAALFGDTVPPKLKIPFILRTPHM
SAMHHDTSPDLKIVGSKLKDILEISNTSLKTRKIIVELCDIVATRGARLSAAGIFGILKK
LGRDTVREEKQKSVVALDGGLFEHYTKFRTAMESTLNELLGDDVAGNIVIEHSNDGSGIG
AALLAASHSQYLEVDSQYLEVDES
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggttgcggtgggagcggcggtggtgtgcgcagctgcggtttgcgcggcagcg
gcgctagtggtgcgccaccggatgagaaactccgggaagtgggctcgagcaatggtcatt
ctgcgggagttcgaggaaaagtgtggaactcctatcgggaaactgaggcaagttgctgat
gccatggccgtcgagatgcacgctggcctcgcatcggaaggtggtagcaagctcaagatg
ctgattagctacgtcgataatctccccaccggagatgaaaaagggctcttctacgcattg
gatcttggcggtacaaattttcgagtgttgcgtgtgcagttgggagggagagacaatcga
gttgttaagcaagaatttgaggaggtttcgatacctccacacttgatgactggatcttca
gaagcactatttgattttatagctcaagctcttgcaaaatttgttgctgaagagggtgaa
ggctttcacccagcaccgggaaggcaaagggaacttggttttactttctccttccctgtg
agacaaacatcaatatcatcagggacacttattaaatggacaaaaggcttcaacattgaa
gacacggttggggaagatgtggtgggtgaattaaccaaagccatggaaagactgaaactt
gacatgcgtgtaacagctttggtaaatgacacaattggaacgttagcgggaggtagatac
tataataacgatgtaattgctgctgtgattttgggtactgggacaaatgcagcttatgta
gagcgagtccacgctattcctaagtggcatggtctccttcctaaatcaggagaaatggta
attaacatggaatggggcaacttccggtcctcgcatctgccactaacagaatatgatcac
gcattggatgttgagagtttgaaccctggagaacagattttcgaaaagatgatttctggt
atgtacttgggagaaattgtacggagagtattgttcaagatggctgacgaagcagctctc
tttggcgatacggttccacccaaactcaaaattccatttatattgaggacacctcacatg
tctgccatgcatcacgacacatctccggacctcaaaattgttggcagcaaactgaaggat
atcttagagatatctaatacctccctgaaaacaagaaaaataatagtggaactttgtgac
attgttgccacacggggtgcgcgtctgtctgctgctggtatctttggaattctgaagaaa
ctggggagagatacagtccgggaggagaagcagaagtctgtcgtagcactggatggaggg
ttgttcgagcactacactaaattcagaaccgcaatggagagtacgctgaatgagctactc
ggtgacgatgttgctggaaatattgtcatcgagcattcaaatgatggctcgggcattgga
gctgcactgcttgcagcctcgcactctcaatatcttgaggtagactcccaatatctcgag
gtagacgagtcctga

DBGET integrated database retrieval system