KEGG   Momordica charantia (bitter melon): 111025871Help
Entry
111025871         CDS       T05045                                 

Definition
(RefSeq) acetylornithine deacetylase-like
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00220  Arginine biosynthesis
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
mcha01210  2-Oxocarboxylic acid metabolism
mcha01230  Biosynthesis of amino acids
Module
mcha_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111025871
Enzymes [BR:mcha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     111025871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Egg_lysin
Motif
Other DBs
NCBI-GeneID: 111025871
NCBI-ProteinID: XP_022159458
LinkDB All DBs
Position
Unknown
AA seq 440 aa AA seqDB search
MAYSSSIKEILGELKKESYIPLLSKLIGESKFVQNNPPEDLIPEEDRIVNHVIEVLDPHS
SRNGGPLVINHVSHVPXRGSLIVEYPGTVPGKVVSFVGSHMDVVPADPATWKFCPFSLSV
EGDQLRGRGTTDCLGHVALLTELLKKLAETKLQLKSSIVVIFIASEENNSIPGVGVEQLA
EKGYFDKLKGGPLYWIDTADSQPCIGTGGSIPWTLVMKGKLFHSGLPHQAINAMELAMEA
LKVIQLRFYEDFPPHPKEKIYGFATPSTMKPTQWSYPGGGNNQIPGECTISGDIRLTPFY
NVKDVISKVQSYVDYINKNIEKLDTRGPVSKYVLPDGYRGSIDIQFGKAMSGVACDLESR
GYQFLYKATEEVVGHVKPYSITGSLPLIRDLQDNGYDVQTAGYGLLVTYHADNEYCLFKD
MDNGYKVFASIISQLEEDCT
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcttatagttcttccatcaaagagattctgggtgaactgaagaaggagtcgtacatc
cctttactttcgaagctaatcggcgagtccaagttcgtccagaacaatccaccggaggac
ctgattcctgaagaggacaggatcgttaatcacgttatcgaagttctcgatcctcacagt
tcgaggaatggcggaccgttggtgataaaccatgtgagccacgttcctgrccgtggaagt
ctgatcgtggagtatccgggcactgtgcctggaaaagtagtttcattcgtcggaagtcac
atggacgtcgtccctgctgatcctgccacttggaaattttgtcctttctcattgagtgtt
gagggggatcaacttcggggtcgtgggactactgactgcctgggacatgttgcccttctt
actgaactcctgaagaagcttgcagaaacaaaactacagttgaagtcctctattgttgtt
atatttattgcctctgaagagaataattcaatcccaggcgttggagtagaacaacttgcg
gaaaaaggatactttgataagttaaaaggagggcctttatattggattgatacagcagat
tcacaaccttgtattggtactgggggttcgataccttggacacttgtaatgaaaggaaaa
cttttccacagtggtttgccacaccaggctattaatgctatggagctagctatggaagct
ctcaaagtgatccaattgcgcttttacgaagattttcctcctcatcctaaggaaaagata
tatggatttgcaactccatcaaccatgaaaccaacacaatggagttatccaggaggtggt
aacaatcaaattccaggagaatgtactatttcaggagatatcaggttaactcccttctac
aatgtgaaagacgttatttcaaaagtccaaagctatgttgattatattaataaaaacatc
gagaaactggatacaaggggtccagtttcaaaatatgtcctaccagatggctacagggga
agtattgatatccaatttggtaaggcgatgtcaggagtcgcatgtgatcttgagtctcgt
ggctatcaatttttatataaggcaacagaggaagttgtgggacatgtcaaaccttactca
attacagggagtttgccacttattcgagaccttcaggataatggctatgatgttcagact
gcaggctatggtttattggttacataccatgcagataatgagtactgtctttttaaagat
atggacaatggctacaaggtttttgctagcatcatctctcaattagaagaagattgtact
taa

DBGET integrated database retrieval system