KEGG   Mycobacteroides chelonae: BB28_01370Help
Entry
BB28_01370        CDS       T04665                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mche  Mycobacteroides chelonae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ANA96523
LinkDB All DBs
Position
complement(268181..269212)
Genome map
AA seq 343 aa AA seqDB search
MLAKPVAKIPADASYEPKWDGFRSIVFRDGNEVELGSRNEKPLTRYFPELVAAVLAELPP
RCVVDGEIVIATESGLDFEALQQRIHPADSRVRLLAEQTPASFIAFDLLALGDEDFTGRP
FSERRAALTDALSGAGTSIHLTPATTDPDTAQRWFEEFEGAGTDGLIAKPLAIAYQPDKR
VMFKIKPERTADCVVAGYRVHKSGDDAIGSLLLGLYQDDGVLASVGVIGAFPMAERKRLF
HELQPLVTALEDHPWNWAAHQAGERTPQKNAGSRWNAGKDLSFVALRPERVVEVRYDHME
GVRFRHTAQFNRWRPDRDPSSCTYEQLERPVAFSLNEIVPGLV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcgaaacctgtcgcgaaaatcccggccgacgcgtcatacgagcccaagtgggat
gggttcaggtcgatcgtctttcgcgacggcaacgaggtggagctgggcagtcgcaacgaa
aagccgctaacccggtacttcccggagctggtggcagccgtgctggccgagctgccgccg
cggtgcgttgtcgacggggagatcgtgatcgccaccgaatccgggctggacttcgaggcg
ctgcagcagcggattcatccggccgattcccgggtgcggctgctggctgagcagacgccc
gcctcattcatcgctttcgacctgctcgcgctgggtgacgaggacttcaccggacgaccg
ttcagcgagcgccgtgccgccctgacggatgcgctgtccggggccggcacctcgattcat
ctcacccccgccaccaccgatcccgacacggcacagcgctggttcgaggagttcgagggt
gccggaaccgacggcctcatcgcgaaaccactggcgatcgcctaccagcccgacaaacgg
gtgatgttcaagatcaaacccgagcgcaccgccgattgcgtggtggccggatatcgggtg
cacaagtccggtgatgacgccatcggatcgctgctgctcggcctgtaccaggacgacggt
gtgttggcctcggtcggtgtgatcggcgcgtttccgatggccgaacgcaagcggctcttc
cacgagctgcaaccgctcgtcactgccctggaggatcacccctggaactgggcggctcat
caggccggtgaacgcactccgcagaagaacgccggctcacgctggaatgccggcaaggac
ctctcgtttgtcgcgctgcgccccgaacgggtggtggaggtccgctatgaccacatggag
ggcgtgcggtttcgccacaccgcccaattcaaccgctggcgcccggatcgcgatccgtct
tcctgcacctatgaacagctcgaacggccagttgcgtttagtctcaacgagattgttccg
ggcctggtgtga

DBGET integrated database retrieval system