KEGG   Mycobacteroides chelonae: BB28_10115Help
Entry
BB28_10115        CDS       T04665                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mche  Mycobacteroides chelonae
Pathway
mche00020  Citrate cycle (TCA cycle)
mche00310  Lysine degradation
mche00380  Tryptophan metabolism
mche01100  Metabolic pathways
mche01110  Biosynthesis of secondary metabolites
mche01120  Microbial metabolism in diverse environments
mche01130  Biosynthesis of antibiotics
mche01200  Carbon metabolism
Module
mche_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mche_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mche00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB28_10115
  09105 Amino acid metabolism
   00310 Lysine degradation
    BB28_10115
   00380 Tryptophan metabolism
    BB28_10115
Enzymes [BR:mche01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BB28_10115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ANA98035
LinkDB All DBs
Position
complement(1986751..1988514)
Genome map
AA seq 587 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVQVDEPLLEVSTDKVDTEIPAPTSGVLTKIV
AREDDTVEIGGELGVISEAGEAESAESAPAPEAAAPAPEPAPAPEPEPEPAPAPAAEPAA
PAPAPAADAPAGPGTSVKMPELGESVTEGTVTRWLKKVGDEVGVDEPLVEVSTDKVDTEI
PSPVAGVLLSISANEDDTVAVGGELGVIGADGAAPAAAPAPAPAPEPAAAPPAPPAPAPA
PAAPAAPAPAPAAPAPAAPAAPAPAPAAAADAGENPYVTPLVRKLASENNVDLSALTGSG
VGGRIRKQDVLAAAEAAKAPAPAAAAAPAAAASSAPAAPAAPAALAHLRGTTQKANRIRQ
LTAKKTRESLQQTAQLTQTHEVDVTKIAALRARAKATFAEREGVNLTFLPFFAKAAVEAL
KSHPNVNASYNEDSKEITYFDAEHLGIAVDTDQGLLSPVIHNAGDLSLAGLARAIADIAT
RARSGNLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIRDEAGN
ESIGIRSVCYLPLTYDHRLIDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgccctcggtgagagcgtgaccgaagggacggtgaca
cggtggctcaaacaagagggcgacacggtccaagtcgacgagccgctgctcgaggtttcc
accgacaaggtagacaccgagatccccgctcccacttcgggtgtgctgaccaagatcgtt
gcccgcgaggatgacaccgtcgaaatcggcggcgagctgggcgtgatcagtgaggccggc
gaagcagagtccgcggagtccgcgcccgcccccgaggccgccgcgccggctcccgagcct
gcacccgctcccgaaccggagcccgaacccgcgcctgctcccgcggcggaaccggccgcc
cctgctcctgctcccgccgcggacgctccggcgggccccggcacctcggtcaagatgccc
gagctcggcgagtcggtcaccgagggcaccgtgacccgctggctcaagaaggtcggcgac
gaggtcggcgtggatgagccgctcgtcgaggtttcgaccgacaaggtcgacaccgagatt
ccgtcgccggtcgccggtgtgctgctgagcatctcggccaacgaagacgacaccgtcgcc
gtcggtggcgaactcggcgtcatcggtgcggacggcgccgcgcctgccgcggcacccgca
ccagcgcctgcccctgaacccgccgcggctccgcccgcgcccccagcgcccgcaccagcc
ccagcggcacccgcagcgccggctccggcgcctgccgcacctgcgccggccgctcccgca
gcacccgcaccagcgcccgctgccgccgccgacgcgggcgagaacccgtacgtcaccccg
ctggtccgcaagctcgcgtccgagaacaacgtggatctgtccgcgctgaccggcagtggt
gtgggtggacgtattcgcaagcaagacgtcctggcggccgcagaggcggccaaggcccct
gcacctgcagcagcggcagcccccgcggcagctgcgtcatcggctccggcggctccggcg
gctcctgccgcactggcccacctgcgcggaaccacgcagaaggccaaccggattcgtcag
ctcaccgccaagaagacacgcgaatcgctgcaacagaccgcgcagctgacccagacccac
gaggtcgacgtcaccaagatcgcggcgctacgggctcgcgcgaaggcgaccttcgccgag
cgtgaaggcgtcaacctgaccttcctgcccttcttcgccaaggccgcggtggaggcgctc
aagtcgcacccgaacgtcaacgcgagctacaacgaggacagcaaggagatcacctacttc
gatgccgagcatctgggcatcgcggtagacaccgatcaaggtctgctgtctccggtgatc
cacaacgccggtgatctgtcgctggccgggctggcccgggccatcgccgatatcgccacc
cgcgcgcgctccgggaacctcaagcccgacgagctcgccggtggcaccttcaccatcacc
aacatcggcagccaaggcgcattgttcgacaccccgatcctggtgccgccgcaggccgcc
atgctcggcaccggcgcaatcgtgaagcgtcccagggtgatccgggacgaagcgggtaac
gaatcgatcggtatccggtcggtgtgctacctgccactgacctacgatcaccgcctgatc
gacggagccgacgcggggcggttcctcaccaccatcaaacatcgcctggaagagggggct
ttcgaggcggacctgggtctgtaa

DBGET integrated database retrieval system