KEGG   Mycobacteroides chelonae: BB28_14195Help
Entry
BB28_14195        CDS       T04665                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mche  Mycobacteroides chelonae
Pathway
mche00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mche01100  Metabolic pathways
mche01110  Biosynthesis of secondary metabolites
mche01130  Biosynthesis of antibiotics
mche01230  Biosynthesis of amino acids
Module
mche_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mche00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BB28_14195
Enzymes [BR:mche01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BB28_14195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 KTI12 AAA_17 AAA_5 AAA_22 6PF2K AAA AAA_24 MMR_HSR1 Cytidylate_kin AAA_16 AAA_28 Mg_chelatase ABC_tran Ras
Motif
Other DBs
NCBI-ProteinID: ANA98803
LinkDB All DBs
Position
complement(2821200..2821847)
Genome map
AA seq 215 aa AA seqDB search
MSPKAVLVGLPGSGKSTIGRRLAKALNVNVYDTDIGIEAQAGRTIADIFATDGEPEFRRI
EESVIRQALDQQDGVVSLGGGAVLTPGVREALTGHTVVYLEISAAEGIRRTGGSVVRPLL
AGPDRAEKYHALISQRVPLYREVATIKVNTDRRNPGAVVRTIVSRLENPEAGTTASSRRR
RPRRRPRSRRRTSGTPAATKSDTPGTETKGRADND
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagccccaaagccgtccttgtcggactgcccggatcgggtaagtccaccatcggccgt
cgcctggcaaaagcgttgaacgtcaacgtctatgacaccgacatcggcatcgaggcgcag
gccggccgcaccatcgccgacatcttcgccaccgatggggagccggaattccggcgtatc
gaagaatcggtgattcggcaggcgcttgatcagcaggacggggtggtctcgctcggcggt
ggcgccgtgctcactccaggcgtccgggaagcactcacggggcataccgtggtgtacctg
gaaatcagtgccgcggaaggaatccgacgcaccggaggaagcgtggtgcgtccgctgctg
gctgggccggaccgcgccgagaagtaccacgccctcatctcgcagcgagttccgctgtac
cgagaggtcgccaccatcaaggtcaacaccgacaggcgaaatcccggcgcagtggtccgg
accatcgtgtcccggttggagaacccagaggctggcaccacagcttcctcacggcggcga
cgcccccgacgacgtccccgatcgcggcgccgtacctccggtactcccgcggcaaccaag
agcgatacccccggaaccgaaactaaaggaagagccgacaatgactag

DBGET integrated database retrieval system