KEGG   Mycobacteroides chelonae: BB28_18690Help
Entry
BB28_18690        CDS       T04665                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mche  Mycobacteroides chelonae
Pathway
mche00564  Glycerophospholipid metabolism
mche01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mche00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BB28_18690
Enzymes [BR:mche01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BB28_18690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA 3HCDH_N AlaDh_PNT_C NAD_binding_8 Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: ANA99628
LinkDB All DBs
Position
complement(3746635..3748401)
Genome map
AA seq 588 aa AA seqDB search
MSDATSPSAGGPTYTFLGPQARSLNWERLGSEQFDVIVIGGGVVGAGSALDAATRGLKVA
LVEARDFAAGTSSRSSKMFHGGLRYLEQLEFGLVQEALRERELSLSTLAPHLVKPLPFLF
PLTNRWWERPYIAAGIFLYDQMGGAKSVPAQKHLTRAGALRLAPGLKRNSLIGGIRYYDT
VVDDARHTMNVARTAAHYGAVVRTSTQVVSLLREGDRVTGVVVRDTENGAETEVRGHVVV
NATGVWTDEIQALSRTRGRFRVTASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGNH
WIIGTTDTEWNLDLAHPAATKVDIDYILDKVNTVLATPLTHNDIDGVYAGLRPLLAGEDD
DTSKLSREHAVAVAAPGLVAIAGGKYTTYRVMASDAIDMASEFVPARVAPSITEKVPLLG
ADGYFALINQTEHVGETYGLHPYRVRHLLDRYGSLIGEVLACAGSDHSLLQPIAKAPMYL
RVEALYAVAAEGALHLEDILARRMRIAIEYPHRGVDCAQEVAELVAPVLGWSAEDIVREV
DTYRARVDAEVRSQRQPDDASADALRVAAPEARSFIVEPVTDVLSPSK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacgcaaccagcccatcggcgggtggacccacatacacgttccttggaccacag
gcccgttcgctgaactgggagcgcctgggatccgagcagttcgatgtcatcgtgatcggc
gggggtgtggtcggcgccggatcggctctggatgccgccacgcgcgggctgaaggtggcg
ttggtcgaggcgcgtgacttcgcggccgggacatcgagccgctcctcgaagatgttccac
ggcggcctgcgctacctcgagcagctcgaattcgggttggttcaggaggcattgcgcgag
cgggagttatcgctctcgacattggcacctcatctggtcaagccgctgccgttcttgttc
ccgctgaccaatcggtggtgggaacgtccctacattgccgccgggatcttcttgtatgac
cagatgggcggcgcgaaatctgttcccgcccagaagcatctcacccgcgccggtgcgctg
cggctggcgccggggctgaagcgcaactcgctcatcggaggtatccgctactacgacacc
gtggtcgacgacgctcggcacaccatgaatgtggcccggacggcggcacactacggggcc
gtggtcaggacatccactcaggtggtctcgctgctgcgtgagggtgatcgcgtcaccggc
gtggtggtgcgggacaccgagaacggcgccgaaaccgaggttcgcgggcatgttgtcgtc
aatgccaccggggtgtggaccgatgagattcaggcgctgtcgcgcacccgtggccggttc
cgggttacggcctccaagggtgtgcacatcgtggtgccacgggacagaatcgtcagcgag
gtggcgatcatcctgcggaccgaaaagtcggtgctgttcgtcatcccgtggggtaaccac
tggatcatcgggaccaccgacaccgaatggaatctggacctggcgcacccggcggccacc
aaagtcgatatcgactacatcctggacaaggtgaacacggtgttggcaacaccgttgacg
cacaacgatatcgatggtgtctacgcgggattgcggccgctgctggccggtgaggatgat
gacacatccaagctctcccgcgagcacgccgtggcggtcgccgctccggggctcgtggcc
attgctggtggcaagtacacgacgtatcgcgtgatggcctccgatgccattgacatggca
agcgaattcgtgccggcgcgggtggcgccctcgatcaccgagaaggttccgctgctgggc
gccgacgggtacttcgcgctgatcaatcagaccgaacacgtcggagagacctacgggctg
catccgtaccgggttcggcatctgttggaccgatacggttcgctgatcggcgaggtgctg
gcttgtgcgggatccgatcacagcctgttgcagccgatcgcgaaggcgccgatgtatttg
agggtggaggcgctctacgcggtggcggccgagggtgccttgcacctggaggacatcctc
gcccggcgcatgcgcattgccatcgagtacccgcatcgtggtgtcgactgtgcccaggag
gtcgccgagctggtggctccggtgcttggctggtccgcggaagacattgtgcgtgaggtg
gatacctaccgtgcgcgggtcgacgccgaggtacgttcgcaacgtcagcccgatgatgcg
tcggcggatgcgttgcgggtggccgcacccgaggcgcggtcgttcatcgtcgaaccggtg
accgacgtattgtcgccgtccaagtaa

DBGET integrated database retrieval system