KEGG   Mycobacteroides chelonae: BB28_22650Help
Entry
BB28_22650        CDS       T04665                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mche  Mycobacteroides chelonae
Pathway
mche00020  Citrate cycle (TCA cycle)
mche00190  Oxidative phosphorylation
mche00650  Butanoate metabolism
mche01100  Metabolic pathways
mche01110  Biosynthesis of secondary metabolites
mche01120  Microbial metabolism in diverse environments
mche01130  Biosynthesis of antibiotics
mche01200  Carbon metabolism
Module
mche_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mche_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mche_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mche00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB28_22650 (sdhA)
   00650 Butanoate metabolism
    BB28_22650 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BB28_22650 (sdhA)
Enzymes [BR:mche01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BB28_22650 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BB28_22650 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 HI0933_like GIDA AlaDh_PNT_C Pyr_redox_3 FAD_oxidored Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ANB00358
LinkDB All DBs
Position
4547268..4549181
Genome map
AA seq 637 aa AA seqDB search
MAELERHQYDVVVIGAGGAGLRAVIEAREQGFKVAVVCKSLFGKAHTVMAEGGCAASMGN
ANDKDSWQVHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRTKDGRISQRN
FGGHTYPRLAHVGDRTGLEIIRTMQQKIVSLQQEDFAETGDYEARIKIFAECTITDLLLD
GDRIAGGFGYWRESGRFILFEAPAVVLATGGIGKSFKVSSNSWEYTGDGHALALRAGGTL
INMEFIQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSEGKRFMFDYIPAVFKGQYAETE
EEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTPHGGVYLDIASRIPTEEIKRR
LPSMYHQFKELAEVDITKDDMEVGPTCHYVMGGIEVDPDSGAATVPGLFAAGECSGGMHG
SNRLGGNSLSDLLVFGRRAGLGAAEYVKGLTSRPQISEADVDKAAVLALAPFGDPAAEGA
ENPYTLHTDLQQAMNDLVGIIRKEEEVEQALVKLNELKERFKHVAVEGHRQFNPGWHLAI
DMRNMLLVSECVAKAALLRTESRGGHTRDDHPDMDATWRKTLLVCSTTGGDPAVPDVLVT
PEPQLPLRPDLLELFEIGELEKYFTPEELAEHPGRKS
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactcgaacggcaccaatacgacgtagtcgtgatcggtgccggtggcgccgga
ctgcgcgccgtcatcgaggcacgtgaacagggctttaaggtcgcggttgtctgtaaatcc
ctgttcggcaaggcacacaccgtgatggccgaaggcggttgcgccgcctcaatgggtaac
gccaacgacaaggacagctggcaggtgcacttcggtgacaccatgcgcggcggcaagttc
ctgaataactggcggatggccgagttgcacgccaaggaggccccggaccgggtctgggaa
ctggaaacctatggcgcgttgttcgatcgcaccaaggatggccggatcagccagcgcaac
ttcggcggccacacctatccgcggctggcgcacgtgggtgatcgcaccggcctggagatc
atccgcaccatgcagcagaaaatcgtctcgctacagcaggaagactttgccgaaaccggt
gattacgaggcacgtatcaagatcttcgccgagtgcaccatcacggatctgctcctggac
ggggaccggatcgccggtgggttcggatactggcgcgaatcgggccggttcatcctcttc
gaggctcccgcagtggttttggccacgggcggcattggcaagtcgttcaaggtgtcgtcg
aactcctgggagtacaccggtgacgggcacgccctggcgctgcgcgccggcggcacgctg
atcaacatggagttcatccagttccatccgaccggcatggtctggccaccctcggtcaag
ggcatcctggtcaccgaaggtgtgcgcggcgacggcggagtgctcaagaactccgagggt
aagcgattcatgttcgactacatccccgcggtgttcaagggtcaatacgccgagaccgag
gaagaagccgaccaatggctcaaggacaacgactcggcacggcgcacccccgacctgctg
ccccgtgacgaggtcgcccgggccatcaactccgaagtcaaggccggtcgcggcaccccg
cacggcggcgtgtacctggacatcgcttcacgcatccccaccgaggagatcaagaggcgg
ctgccgtcgatgtaccaccagttcaaggaactcgccgaggtcgacatcaccaaggacgac
atggaagtcggtccgacctgtcactacgtgatgggcggtatcgaggtcgatcccgacagt
ggagccgcgacggtgcccggtctcttcgcggccggtgaatgctccggcggcatgcacggg
tcaaaccggttgggcggcaactccctttccgacctgctcgtgttcgggcggcgcgccggc
ctgggtgccgccgagtacgtcaagggcctcacgtctcgtccgcagatctccgaggccgac
gtcgacaaggccgccgtactcgctttggcacccttcggagaccccgctgccgagggtgcc
gaaaatccgtacacactgcacaccgacttgcagcaggccatgaacgacctggtcggcatc
atccgcaaggaagaggaagtcgaacaggccctggtcaagctgaacgagctcaaggagcgc
ttcaaacacgttgccgtggaagggcaccggcagttcaatccgggctggcacctggccatc
gacatgcgcaatatgctgctggtcagtgagtgcgtggccaaggcggcgctgctgcgcacc
gagagccgaggcgggcacacccgcgatgaccatccggacatggatgccacctggcgcaag
accctactggtgtgcagcaccaccggcggagatccggcggtacccgatgtactcgtcacg
cccgagccgcagctccccttgcgcccagatcttttggaactgttcgagatcggcgagctg
gagaagtacttcacgcccgaagaactggcagagcacccaggaaggaagtcctga

DBGET integrated database retrieval system