KEGG   Mycobacteroides chelonae: BB28_22710Help
Entry
BB28_22710        CDS       T04665                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mche  Mycobacteroides chelonae
Brite
KEGG Orthology (KO) [BR:mche00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mche01001]
    BB28_22710
Enzymes [BR:mche01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BB28_22710
Protein kinases [BR:mche01001]
 Serine/threonine kinases: Other
  Bacterial family
   BB28_22710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH DUF2749
Motif
Other DBs
NCBI-ProteinID: ANB00369
LinkDB All DBs
Position
4555740..4557506
Genome map
AA seq 588 aa AA seqDB search
MTSSEMPPSGPDNQQPGDLPPGTVISGYQIERVLGRGGMGTVYLAANPNLQRPEALKILN
AQASRDPDFRARFMREASLAASLDHPNIVTVHNRGETPEGDLWIAMQYVQGSDAHSESRN
GRMSLTRAIHIISEVAKALDYLHARGLVHRDVKPANILLSEGDRRIMLGDFGVTRALDDS
NSVTSAGNVTATIGYAAPEVLSGAAVDGRADVYALGCTLFRMLTGQPPFGSGGSLPAVIN
AHLSAPPPRISQFASVPESMDALIAKAMAKNPADRYQSAGEFAQAAQQILADPHQHRQTV
TQPVSTVTPQPTPLLAQNIATPTDSARTLVKHRRIVAIVGAVALVAASTVVAVVIWPRHG
GGGKPTPSSGATAAVVKPGESLAGQPNTVLDTLLPGQFDYPDGWEKNPSPTFRSGEFNPA
VAPGAATIVGGTPVGCNTIDPVWALRAQGRETSTLYLRDRKKPEREILIRVVPASDALSP
DGASDALKRCDAVAYTIPGASTTWRCSFEFDEPAPVQNGQKELTATESCFMFPSGANSIR
QHVSFNVVRGLLVYILASGASNRNDAAGSLSATALNFATAMRILRYGR
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatcggagatgccgccgtcgggtccagataaccagcaacctggagacctaccg
ccgggaacggtcatatccggataccagatcgagcgcgtcctcggtcgcggcggcatgggc
accgtgtatctggccgcaaatccgaatttgcaacgtcccgaggctctgaagatcctcaac
gcccaggcctcacgcgaccctgatttccgggcacgattcatgcgcgaggcctcgctggcc
gcgtctctggatcaccccaacatcgtcacggtgcacaaccgaggcgaaacgccggagggc
gatctgtggattgccatgcaatacgtccagggcagcgatgcacactcggagtcgaggaat
ggacgcatgtcgctcacccgcgccattcacatcatcagcgaggtggccaaggcgcttgac
tatctgcatgcccgcggtctggtacaccgcgatgtgaagccggccaacatcctgctgtcc
gagggcgatcgtcgaatcatgttgggcgacttcggtgtcactcgcgcgctcgacgacagc
aactcggttacctccgcggggaacgtgaccgccacgatcgggtacgcggcgccggaggtg
ctgtccggcgccgccgtcgacggccgcgccgatgtgtatgccttgggctgcacgctcttt
cggatgctcacgggtcaacccccgtttggctccgggggctcgctacccgcggttatcaat
gcacacctctcggcgccgccgccccgcatctcccagttcgcctctgtgcccgagtcaatg
gacgcattgatcgccaaggcgatggccaagaatcccgccgatcgatatcaaagtgccggg
gagtttgcccaggccgcgcaacagattctggccgacccgcatcagcaccggcagaccgtg
acccaacccgtatccaccgtgacgccgcagcccacacctcttctcgcacagaacatcgca
acaccgacagactccgcgcgaacattggtcaagcacagacgcattgtggcgattgtcggc
gccgtcgccctagtggccgcatcgacggtggtcgccgtagtgatctggccccgccatggc
ggcggaggtaaacccactccctcgtctggcgcgaccgccgcggtggttaagccgggcgaa
tcgctggccggacaacccaataccgtcctggacaccttgctgcccggccagttcgactac
ccagacggatgggagaagaacccatcgcccacattcaggtcgggcgagttcaatccggcc
gtggcgcccggtgcggccaccatcgttggtggaaccccagtgggctgcaacacgattgat
cccgtgtgggcactacgcgcccaaggccgtgagacctcgacgttgtatctgcgtgatcgc
aagaagcccgagagagagatcctgatccgggttgtcccggcatccgatgccctctccccg
gacggcgcctctgacgcattgaagcggtgcgacgcggtcgcgtacacgatccccggcgcg
agcaccacgtggcgatgctcgttcgagttcgatgagccggctccggtccagaatggccaa
aaagagctcaccgcaacggaatcgtgctttatgtttccctccggggcgaacagcattcga
cagcacgtgtcattcaatgtggtacgcggcctgctcgtgtacatcctggccagcggtgcg
tcgaaccgaaacgacgcggcaggctctctgagcgcgaccgccctgaacttcgcgaccgcc
atgaggatcctgcgttacggccgctag

DBGET integrated database retrieval system