KEGG   Mycobacteroides chelonae: BB28_24120Help
Entry
BB28_24120        CDS       T04665                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mche  Mycobacteroides chelonae
Pathway
mche00620  Pyruvate metabolism
mche00680  Methane metabolism
mche01100  Metabolic pathways
mche01120  Microbial metabolism in diverse environments
mche01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mche00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BB28_24120
  Energy metabolism
   00680 Methane metabolism
    BB28_24120
Enzymes [BR:mche01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BB28_24120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ANB00638
LinkDB All DBs
Position
4880633..4883422
Genome map
AA seq 929 aa AA seqDB search
MAEVTDLAPIGAVTRTQVGREATEPMREDIRLLGTILGLTVREQCGDEVFELVERARVES
FRVRRSEIDRAELAQLFDGVDIHRAIPVIRAFTHFALLANVAEDIHRERRRAVHVAAGAP
PQDSSLAATYLKLDAAQLSSDRVAHALTGALVSPVITAHPTETRRRTVFDTQHRITELMR
LRMQGLSQTESGRNIEHELQRHILTLWQTALIRLSRLKIQDEIAVGLRYYQASFFEVIPE
INAEIRTALRRRWPDAELLSEPILRPGSWIGGDRDGNPNVTAEVVHLATSSAAQTAIAYY
FEQLVALEQELSLSVRLVTVSADLLALAEQGRETDRADEPYRRALRVIHARLTATAANIL
DQLPEHGLDLDLIPYRTPDELLRDLDIVDASLRAHGSVVLADDRLRALRESIHVFGFHLS
GLDMRQNSDVHEEVVSELLAWAGVHSDYRSLSEQQRIEVLVTELRTRRPLIGEGAELSEL
ARKELDIVAAAARAVQTYGPRAVPNYIISMCQSVSDMLEAAILLKEAGLLDASRPRPFCP
VGIVPLFETIDDLQRGSAILEAALELPLYRALVAARGESQEVMLGYSDSNKDGGYLAANW
ALYRAELDLVESARRNGIRLRLFHGRGGTVGRGGGPSYDAILAQPPGAVSGSLRITEQGE
VIAAKYAEPRAAHRNLETLLAATLESTLLDVEGLGEAAGAAYEILDDLAARAQRTYRELV
HETPGFVEYFKASTPVNEIGALNIGSRPTSRKPTTSIADLRAIPWVLAWSQSRVMLPGWY
GTGAAIEQWIAEGDGRLEVLQQLYRRWPFFQTVLSNMAQVLAKSDMGLASRYAELVDDET
LRHRVFDKIVAEHDRTIAMHQLITGHEDLLADNPALARSVFNRFPYLEPLNHLQVELLRR
YRSGDQDELVQRGILLTMSGLATALRNSG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggttacggatcttgcaccgataggcgccgtcacccggacacaggtgggccgg
gaggccaccgagccgatgcgcgaagacatccggctgctgggcaccatcttgggtcttacg
gtgcgtgagcagtgcggcgacgaagtcttcgagctcgtggagcgggcgcgagtggagtca
ttccgcgtgcgccgatcagagatcgatcgcgccgaactggcgcagctgttcgacggcgtc
gatatccatcgagccatccccgtcattcgggctttcacccatttcgcgctgctggccaat
gtggccgaggatatccatcgagagcgtcggcgggccgtgcacgtcgccgcgggcgcacca
ccgcaggacagtagtctcgccgccacgtatctcaaactcgatgccgcacaactttcttcc
gatcgcgttgcgcacgccctcaccggcgcgctggtgtcgccggtcattaccgctcacccg
acggagacccgccgacgcaccgtgttcgacacccaacatcgcatcaccgaactcatgcgg
ctacgcatgcagggactgtcgcagaccgaatccggccggaatatcgagcacgaacttcag
cgacacattctcacactgtggcagacggcattgatccggttgtcccggttgaagattcaa
gacgaaatcgccgtggggctgcgctactaccaggcctcgttcttcgaggtgatacctgag
atcaatgccgagatccgaacggcgttacgccgccggtggccggacgccgaattgctcagc
gaaccgattctgcgacccggctcgtggatcggtggcgaccgggacgggaatccgaacgtc
accgccgaggtagtgcatcttgcgacaagtagtgccgcacagacggcgatcgcctactac
ttcgaacaattggtggcgctggaacaggagctctccctatcggtccgtctggtcacggtt
tctgccgatctactcgcattggccgagcagggccgcgaaaccgaccgggcagacgagccc
taccgtcgtgcactacgcgtcatccacgcgcgccttaccgcgacggccgcgaacatcctt
gaccagctgccggagcacggcctggatctagacctgattccgtaccgcacaccggacgag
ctactgcgagatctcgatatcgtggacgcttcgttgcgcgcacacggcagcgtggtgttg
gcggatgatcgactgcgcgcgctacgagaatccattcatgtcttcggttttcatctcagt
gggctggacatgcggcagaactcagatgtccacgaagaggtagtttccgagttacttgcc
tgggccggtgtgcattcggactaccgatcgctctcggagcagcagcgtatcgaggtactt
gtcaccgagctacgtacccgccgccccttgatcggcgagggtgccgagctctccgagctt
gcccgcaaggaactcgatatcgtcgccgctgctgcgcgggcggttcagacatacggcccc
agggcggttcccaactacatcatctcgatgtgccaatcggtttcagacatgctggaagcg
gcgattctcctgaaagaagcaggattgcttgacgcttcacggccacgaccattctgtccg
gtgggcatcgtgccgctgttcgagacgattgacgacctgcaacgtggttccgccattctc
gaagcagccctggaacttccgctctaccgggccctggtggcagctcgaggcgaaagccag
gaagtgatgctcggatactcggactccaacaaggatggcggctatctggctgccaactgg
gcgctgtaccgcgccgaactggacctggtggaatcggcccgcaggaatgggattcgcttg
cggctcttccatggccgcggtggcaccgtaggacgcggtggcggtccgagttacgacgct
attctggcccaaccccccggggcggtgtccgggtcgcttcgtatcaccgagcagggcgag
gtgatcgccgccaagtacgccgaaccgcgtgcggcccatcgcaacctcgagacgctgttg
gcggcaacgctggagtcgacactgctcgacgtcgagggattgggagaggcggcgggcgca
gcctacgaaatactcgatgatcttgccgcacgcgcccaacgcacctaccgcgaactggtg
catgaaacaccaggctttgtcgagtatttcaaggcgtcgacaccggtcaacgagatcggc
gcgctcaatatcggcagtcggccaacctcccggaagcccaccacatcgatagccgacctg
cgcgccatcccatgggttttggcctggagccagtctcgggtgatgctgcccggctggtac
ggcacgggcgccgcgatcgagcagtggatcgccgaaggcgacggacgacttgaggtgctg
caacagctctatcgccgatggccgttctttcagacggttctgtcaaacatggcccaggta
ctggccaagtcagacatgggattagcttctcgctatgccgaactcgtcgacgacgaaacc
ttgcggcaccgggtgttcgacaagatcgtggccgagcacgacagaaccattgccatgcat
caattgatcaccgggcatgaggatctgcttgccgacaacccggcgctggcacgttcggtg
ttcaaccgctttccgtacctggagccccttaaccacctacaggtggaactgctgcgccgg
taccggtccggtgatcaggatgagctggtgcagcgcggcatactgctcacgatgagcggt
ctggccaccgcgctacggaacagtggctga

DBGET integrated database retrieval system