KEGG   Mycobacterium chimaera: AN480_00110Help
Entry
AN480_00110       CDS       T04926                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mchi  Mycobacterium chimaera
Brite
KEGG Orthology (KO) [BR:mchi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mchi01001]
    AN480_00110
Enzymes [BR:mchi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AN480_00110
Protein kinases [BR:mchi01001]
 Serine/threonine kinases: Other
  Bacterial family
   AN480_00110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Pkinase_fungal Haspin_kinase RIO1 ABC1
Motif
Other DBs
NCBI-ProteinID: APD83803
UniProt: A0A220Y470
LinkDB All DBs
Position
complement(21361..22632)
Genome map
AA seq 423 aa AA seqDB search
MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAVKVLKQEFSQDPEFIERFRA
EARTTAMLNHPGIAAVHDYGESQLDGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQVAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDATPSSDVYSLGVVGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPAE
LPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQSPPPGRASPAAIPSS
PTTRAAAVSPRSAAPRRSRPTTGGHRPPPARRTFSSGQRALLWAAGVLGALAIIIAVLIV
INSRGDQQQQPPTVTDTGTPPASAPPPTNTPSGSAGMRLEWPDDGTIGMSGFRGGPAGHG
TSQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcgagttggtgtgacgctgtctggcagataccgcctgcagcgcctgatcgcc
accggcggcatgggtcaggtctgggaggccgtggacagccgcctgggccgacgcgtcgcc
gtcaaggtgctcaagcaggagttctcccaagaccccgagttcatcgagcgcttccgcgct
gaggcgcggaccacggcgatgctcaaccaccccgggatcgcggcggtccacgattacggc
gagagccagctggacggggagggccgcaccgcctacctggtgatggagctggtcaacggc
gagccgctgaactcggtgctcaaacgcaccggccggctctcgctgcggcacgccctggac
atgctcgagcagaccggccgcgcgctgcaggtcgcgcacgccgccggtctggtccaccgc
gacgtcaagccgggcaacatcttgatcaccccgaccggccaggtgaagatcaccgacttc
ggcatcgccaaggccgtcgacgccgcgccggtgacccagaccggcatggtcatgggcacc
gcccaatacatcgcgcccgaacaggcgctcgggcacgacgccaccccgtccagtgacgtg
tactcgctgggagttgttggctacgaggttgtttcgggcaagcggccgttcaccggtgac
ggcgccctgaccgtggcgatgaagcacatcaaggaacccccgccgccgctgcccgcggag
ctgccgcccaacgtgcgagaactcatcgagatcacgctggtcaagaacccggcgatgcgg
taccgcagcgggggaccgttcgccgacgccgtcgcggcggtgcgcgccggtcgccgtccg
ccccgccccagccagtcaccgcctccgggccgggcctcgccggcggcgataccgtccagc
ccgacgacccgggcggcggcggtgtccccgcgcagcgcggcgccgcgtcgatcccgcccg
accaccggcgggcaccgcccgcccccggcccggcgcaccttctcgtcggggcagcgcgcg
ctgctctgggccgccggggtactcggcgcgctggcgatcatcatcgcggtgctcatcgtc
atcaattcccggggggatcagcagcaacagcccccgacggtcaccgacaccggcaccccg
ccggcatcggcgcccccgccgaccaacaccccgagcggttcggcaggcatgcgtctcgag
tggccggatgacggcacgatagggatgtcgggattccgcggtgggccggcgggacacggg
acatcgcaatga

DBGET integrated database retrieval system