KEGG   Mycobacterium chimaera: AN480_08410Help
Entry
AN480_08410       CDS       T04926                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mchi  Mycobacterium chimaera
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AOS91468
UniProt: A0A220Y9J9
LinkDB All DBs
Position
complement(1769383..1770849)
Genome map
AA seq 488 aa AA seqDB search
MTKNSDHRCYDEVFIGGQWRKPANPQQLDVISPHSEEPVGHVQAAGPEDVDAAVVAARHA
FDHGPWPRMSHADRMAKVEQLAAIYARHSDDMADLITDEMGSPRSFSRMGQGAAAASLIH
LALAAARDFPWTERRQGVLGEVHLRRAPVGVVGAIVPWNVPQLLIMPKLIPALIAGCTVI
VKPAPETPLDALWLAEMIEQLDLPEGVVSVLPGGTDVGEALVRHPGVDKIAFTGSSAVGR
RIAALCGEQLKRVSLELGGKSAAIILDDADIDKTVAGLKSAGLMNNGQACVAQTRILVSD
RKHDEVVDALAGMMSALHVGDPADEATDIGPLVAQRQQRRVQDYIQSGRREGARVVLGGE
QSPSERGWYVQPTLFADATNDMRIAREEIFGPVLTVLRYRDEDDAIRIANETDYGLAGSV
WTSDIGHGLDVAAAVRTGTYGINMYTLDIGAPFGGFKQSGIGREFGPEGLHEYVELQTLI
CKGQLPPL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaattccgaccatcgttgttacgacgaagtgttcatcggagggcagtggcgc
aagcccgccaatccccaacagctcgacgtgatctcgccgcactccgaggagccggtcggt
cacgtccaggcggccggccccgaggacgtcgacgccgcggttgtcgccgctcggcacgcc
ttcgaccacggaccgtggccgcggatgagccacgccgatcggatggccaaagtcgaacag
ctcgccgcgatctacgcccgccacagcgacgacatggccgacctgatcaccgacgagatg
ggatcaccgcgcagtttcagccggatgggccagggggcggccgccgcgtcgctgatccac
ctcgcgctggccgccgcccgcgactttccgtggaccgaacgccgccagggcgtgctcggc
gaagtgcacctgcgccgtgccccggttggggtggtgggcgcgatcgtgccctggaacgtg
ccccagcttttgatcatgcccaagctgatccccgcgctcatcgcggggtgcacggtgatc
gtcaagcccgcacccgaaacgcctttggacgctttgtggttggccgagatgatcgaacag
ctggacctgcccgagggcgtggtctcggtcctgcccggcggcaccgacgtcggcgaggcg
ctggtgcggcacccgggcgtggacaagatcgcgttcaccgggtccagcgccgtcgggcgc
cggatcgccgccctgtgcggggaacaactgaaacgcgtgagcctggagctgggcggcaag
tcggcggcgatcatcctcgacgacgccgacatcgacaagaccgtggccgggttgaagagc
gcgggcctgatgaacaacggccaggcctgcgtcgcccagacccgcatcctggtcagcgac
cgcaagcacgacgaggtcgtcgacgccctggccggcatgatgtcagcgctgcacgtcggt
gacccggccgacgaggcaacggacatcggaccgcttgtcgcccaacgccaacagcgccgc
gtccaggactacatccagtccggccgccgcgaaggggcccgcgtcgtcctgggtggcgaa
cagagcccgtccgaacgcggctggtacgtgcagccgacgctgttcgccgacgccaccaac
gacatgcgcatcgcccgggaggagattttcgggccggtgctcacggtgctgcgctaccgg
gacgaggacgacgcgatccgcatcgccaacgaaaccgactacggtctggccggttcggtg
tggacgtccgacatcgggcacggcctcgacgtcgcggccgccgtccgcacggggacctac
ggcatcaacatgtacaccctcgacatcggggcaccgttcggcggattcaagcaatccggc
atcgggcgcgagttcggccccgagggtctgcacgagtatgtcgaactgcagacgctgata
tgcaaagggcagctgccacctctatga

DBGET integrated database retrieval system