KEGG   Mycobacterium chimaera: AN480_20020Help
Entry
AN480_20020       CDS       T04926                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mchi  Mycobacterium chimaera
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOS93228
UniProt: A0A220YGN5
LinkDB All DBs
Position
4428102..4429547
Genome map
AA seq 481 aa AA seqDB search
MDHHPAVQIAGNDGARPRAGVLHVISPHTEEPIAEVNAAGSDDVDAAVAAARAAFGPWGR
SEPAERVAAIRRLADIYDGRRAEMATTITAEIGAPISFAQRAQVGLPAFMMRAFCDLAER
HPWQETRPGFFGSDVHVRKEPVGVVAAIVPWNMPQFLIVTKLVPALLAGCAVVLKPAPES
PLDALLLGEMIAEAGLPPGVVSILPGDGALGAYLVAHPGVDKVSFTGSTAAGRAVAASCA
ANLTKVSLELGGKSAALVLDDASPDKVAAGVRSASLSNSGQICNALTRVLVPQGRHDEYV
NALAAEMAGLRVGDPNDPDTQLGPLVSRRQQRRVRDYIEIGQNEGARVVIGGTDMPDGLD
RGWYVRPTLFAAADNSMRIAREEIFGPVITVIPYHDDEEALAIANDSDYGLAGSVWSNDS
DRALAMATRIHTGTVGVNQGYTMDPFAPFGGVKASGYGRELGPEGLDGYLDTKSIAIAAE
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaccatcaccccgcagtgcagatcgccggaaacgatggggcgcggccgcgggccggc
gtcttgcacgtcatctctccgcacaccgaggaaccgatcgccgaggtcaatgcggcggga
tccgacgacgtcgacgcggcggtggcggcggcgcgcgcggccttcgggccctggggccgc
agcgagccggcggaacgggtcgccgcgatccggcgcctggccgacatctacgacggacgc
cgcgccgagatggccaccacgatcacggccgagatcggcgccccgatcagcttcgcccag
cgggcccaggtcggcctgccggcattcatgatgcgcgcgttctgcgaccttgccgaacgg
cacccgtggcaggagaccaggcccgggttcttcggaagcgacgtgcacgtccgcaaggaa
cccgtcggcgtcgtcgcggcgatcgtgccctggaacatgccccagttcctcatcgtcacc
aaactggtgcccgcgctgttggccggctgcgccgtcgtgctcaaacccgcccccgaaagc
ccgttggacgcgctgcttttaggcgagatgatcgccgaagccggcctgccgccgggcgtg
gtcagcatcctgccgggcgacggtgcgctgggcgcctacctcgtcgcccacccgggcgtc
gacaaagtgtcgttcaccggctccaccgcggcggggcgggcggtggccgcatcgtgtgcg
gccaacctcaccaaagtcagcctggaactcggcggcaagtccgccgccctggtcctcgac
gacgcatcgccggacaaggtggccgccggggtgcgatccgcgagcctgtccaacagcggc
cagatctgcaatgcgctcacccgggtcctggtgccgcaggggcgccacgacgagtacgtc
aacgcgctcgccgccgagatggccggccttcgcgtcggcgatcccaacgatcccgacacc
cagctcggcccgttggtgtcccggcgccagcagcgacgcgttcgcgactacatcgagatc
ggccagaacgagggggcgcgcgtcgtcatcggcggcaccgacatgcccgacggactcgac
cgcggctggtatgtccggcccaccctgttcgcggcggccgacaattcgatgcgcatcgcc
cgggaggagatctttgggcccgtcatcaccgtcatcccctaccacgatgacgaggaggcg
ctggcgatcgccaacgattccgattacggcctggccggctcggtgtggagcaacgacagc
gaccgtgcgctggcgatggccacccgcatccacaccgggaccgtcggcgtcaaccagggc
tacacgatggatccgttcgcgcccttcgggggcgtcaaggccagcggctacggccgcgaa
ctcgggcccgaaggcctcgacggttacctggacacgaagtcgatcgcgatcgccgcggaa
tcctag

DBGET integrated database retrieval system