KEGG   Mycobacterium chimaera: AN480_20580Help
Entry
AN480_20580       CDS       T04926                                 

Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mchi  Mycobacterium chimaera
Pathway
mchi00380  Tryptophan metabolism
mchi00630  Glyoxylate and dicarboxylate metabolism
mchi01110  Biosynthesis of secondary metabolites
mchi01130  Biosynthesis of antibiotics
mchi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mchi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AN480_20580
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AN480_20580
Enzymes [BR:mchi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     AN480_20580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AOS93316
UniProt: A0A220YHM0
LinkDB All DBs
Position
4537811..4539913
Genome map
AA seq 700 aa AA seqDB search
MATDQNPKQRDLESARFRRDTGYLTTQQGVRVDHTDDSLSVGERGPTLLEDFHAREKITH
FDHERIPERVVHARGAGAYGYFEPYDDSLAQYTAARFLTTPGLQTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNEIPQAQSA
HDTLWDFVALQPETLHTIMWLMSDRALPRSYRMMQGFGVHTFRLVNDRGEGTFVKFHWKP
RLGVHSLIWDECQKIAGKDPDYNRRDLWEAIESGHYPEWELGVQLVPEEDEFSFDFDLLD
ATKIIPEEQVPVRPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPVAEVRTNQHDGYGQHAIPQGRSSYYKNTIGGGCPALADE
NVFRHYTQRLDGQTMRKRAESFENHYSQARMFWTSMTRVEAEHIVAAFAFELGKVEMPEI
RSAVVAQLARVDGELAAQVAAKLGLPAPPEEQVDTVTASPALSQVTDAGDTIESRKVAVL
AADGVDVVGTQRFIEQMGQRGAVVEVLAPVAGGTLEGGSGGELRVDRSFTTMASVLYDAV
VVACGPRSIATLSNDGYAVHFVTEAYKHLKPIGAYGAGVDLLRTAGITNRLAEDTDVLND
QSVITTKAAADELPDRFVEEFAGALAQHRCWQRRTDPVPA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaccagaatcccaagcagcgcgacctggaatccgcacggttccgccgcgac
acgggatacctgacgacccagcagggcgtccgcgtcgaccacaccgacgattcgctgtcg
gtcggtgagcggggaccgacgctgctggaggactttcacgcccgcgagaagatcacccac
ttcgaccacgagcgcatcccggagcgcgtggtgcacgcgcggggtgccggcgcctacggc
tatttcgaaccgtacgacgactcgttggcgcaatacaccgcggcgagattcttgaccact
ccaggtttgcagaccccggtgttcgtgcgattctccacggtggccggctcgcggggttcg
gccgataccgtgcgcgacgtgcgcggcttcgccaccaagttctacaccgaacaaggcaat
tacgacctggtgggcaacaacttcccggtgttcttcatccaggacggcatcaaattcccc
gatttcgtgcacgcggtgaaaccggagccgcacaacgagattccgcaggcgcagtcggcc
cacgacacgctctgggacttcgtggcgctccagcccgagacactgcacaccatcatgtgg
ctgatgtcggaccgggcattgccgcgtagctaccggatgatgcagggcttcggcgtgcac
accttccggttggtaaacgaccgcggcgagggcactttcgtgaaattccactggaagccg
cggctcggcgtgcactcactgatctgggacgaatgccaaaagatcgccggcaaggacccc
gattacaaccgccgcgacctgtgggaggccatcgagtcgggccactacccggagtgggag
ctcggcgtccagctcgtgcccgaggaggacgagttcagcttcgatttcgaccttctcgac
gcgacgaaaatcattcccgaggaacaggttccggtgcgcccggtgggcaagatggtgttg
aaccgcaacccggacaacttcttcgccgagaccgagcaggtcgcgttccacacggcgaac
gtggtgcccggcatcgacttcaccaacgatccgctgctgcagttccgcaacttctcctac
ctggacacccaactgatccggctgggcggccccaacttcgcccagctgccgatcaatcgg
ccggtggccgaggtccggaccaaccagcacgacggctacggacagcacgcgattccgcag
ggccgctccagctactacaagaacaccatcggcggcggctgcccagcgctggccgacgag
aacgtgttccggcactacacccagcgcctcgacgggcagaccatgcgtaagcgggccgag
tccttcgagaaccactacagccaggcgcggatgttctggaccagcatgacgcgcgtggag
gccgaacacatcgtcgccgcgttcgctttcgagctcggcaaggtggagatgcccgagatc
cgttcggcggtggtggcacagctcgcccgggtcgacggcgaattggccgcccaggtggcc
gcgaagctggggcttcccgcgccgcccgaggagcaggtcgacacggtgaccgcctcgccg
gcgctgtcacaggtcaccgacgccggcgacaccatcgaatcgcgcaaggtcgccgtgctg
gccgccgacggcgtcgatgtggtggggacacagcgctttatcgagcagatgggacagcgc
ggggccgtggtcgaggtgttggctccggtggccggcggcacgctggagggcggatccggc
ggcgaactgcgcgtcgaccggtccttcacgacgatggcgtcggtgctctacgacgcggtc
gtggtggcgtgcgggccgcggtcgatcgcgacgctgtccaacgacgggtatgcggtgcac
ttcgtgaccgaggcctacaagcatctcaagcccatcggggcgtacggcgccggcgtcgac
ctgctgcgcaccgccggcatcaccaaccgcctcgccgaggacaccgacgtcctcaacgac
cagtccgtcatcaccaccaaggccgccgccgacgagttgcccgatcgcttcgtcgaggaa
ttcgccggcgcgctcgcccaacaccgttgctggcagcggcgcaccgacccggttccggcc
tag

DBGET integrated database retrieval system