KEGG   Mycobacterium chimaera: AN480_23300Help
Entry
AN480_23300       CDS       T04926                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mchi  Mycobacterium chimaera
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOS93736
UniProt: A0A1Y0T836
LinkDB All DBs
Position
complement(5119184..5120620)
Genome map
AA seq 478 aa AA seqDB search
MFVGGRWRRPSCDTRIDVISPHTEDVIGYAAAGSARDIDTAVRMARQAFDDGPWPHLAPE
GRIAKVLELADIYAKHVDDMADLITAQMGSPTSFSRLGQAAGPATMMHLSVDVARGFPWV
QHRTGLLGEVLLRRAPVGVVGIIIPWNVPQCLLMPKLIPALLAGCSVVIKPAPETPLDSL
WVAEMIEEAGFPEGVVSVIPGGPEVGEALVSHSGVDKIAFTGNSATGRRIAALCGQQLKR
YSLELGGKSAAIVLEDADIGRTVAGLKTASLMNNGQACVAQTRILVSHRMYDDFVEAMAE
MMAGLQVGDPTDPGTDIGPLVSHRQQQRVRSYIRRGIEAGARMVVGGPEGPRDRGWYVSP
TLFADVSNDMVIAREEIFGPVVCVIPYDDEAEAVRIANDSDFGLAGSVWTRDVPHGLDIA
TRVRTGTYGINMYMLDISTPFGGFKQSGVGREFGPEGLEEYVEIQSIVGAGALPTGGR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttggggggcgctggcgcaggcccagctgcgatacgcgcatcgacgtgatctcg
ccccacaccgaggacgtcatcggctatgccgcagccggttcggcccgcgacattgacacc
gctgtccgtatggcacgacaggcctttgacgacgggccgtggccacacctggcgcccgag
gggcgaatcgccaaagtgcttgagcttgctgacatctacgccaaacacgtcgacgacatg
gccgatctgatcaccgcccagatgggctcgcccaccagcttcagccggctcgggcaagcg
gccggcccggctacgatgatgcatctgtcggtcgatgtcgcgcgtggcttcccatgggtg
cagcaccgcaccggcctgctcggcgaggtccttttgcggcgcgcgccggtgggggtggtc
ggcatcatcatcccgtggaatgtgccgcagtgtctgctcatgcccaagctcatccccgcg
ctgctcgcaggttgctcggtcgtgatcaagccggcgcccgagacgccgctggattcgttg
tgggtagccgaaatgatcgaggaagccggctttcccgagggcgtcgtgtccgtgatccca
ggcggcccggaggtcggcgaagcgctcgtttcgcacagtggagtcgacaagatcgccttc
acgggcaactcggcgaccgggcgacgtatcgcggcactatgtggtcaacagctcaagcgc
tacagcctggagttgggcggaaagtcggctgcgatcgtgctcgaggacgccgacatcggg
cgtaccgtagcgggattgaagacggccagcctaatgaacaacggccaagcgtgcgtggcg
cagacacgaatcctggtcagtcaccgcatgtacgacgacttcgtcgaagccatggcggaa
atgatggccggcctgcaggtgggcgaccccaccgatcccggcaccgatatcggaccgctg
gtctcccaccgtcaacagcaacgggtacggtcttacattcgccgagggatcgaggcgggc
gcacgaatggtggtcggcggccctgaggggccgcgggatcgcggctggtacgtgtcaccg
acgctgttcgccgatgtcagcaacgacatggtgatcgcccgtgaagaaattttcgggccc
gtggtatgtgtcatcccctacgacgacgaagccgaagcggttcgcatcgccaacgacagc
gacttcgggctcgccggctccgtgtggacccgcgacgtcccccacgggctcgacatcgcg
acccgggtgcgcaccggcacgtacggcatcaacatgtacatgctcgacatcagcactccc
ttcggcggattcaaacagtccggggtggggcgggagttcggtcccgaaggccttgaggaa
tatgtggagattcaaagtatcgtcggggccggagccctgccgactggaggccgctga

DBGET integrated database retrieval system