KEGG   Mycobacterium chimaera: AN480_24565Help
Entry
AN480_24565       CDS       T04926                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mchi  Mycobacterium chimaera
Pathway
mchi00220  Arginine biosynthesis
mchi00250  Alanine, aspartate and glutamate metabolism
mchi00290  Valine, leucine and isoleucine biosynthesis
mchi01100  Metabolic pathways
mchi01110  Biosynthesis of secondary metabolites
mchi01130  Biosynthesis of antibiotics
mchi01210  2-Oxocarboxylic acid metabolism
mchi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mchi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AN480_24565
   00290 Valine, leucine and isoleucine biosynthesis
    AN480_24565
   00220 Arginine biosynthesis
    AN480_24565
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mchi01007]
    AN480_24565
Enzymes [BR:mchi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AN480_24565
    2.6.1.66  valine---pyruvate transaminase
     AN480_24565
Amino acid related enzymes [BR:mchi01007]
 Aminotransferase (transaminase)
  Class I
   AN480_24565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AOS93932
UniProt: A0A1Y0T8R9
LinkDB All DBs
Position
5378897..5380201
Genome map
AA seq 434 aa AA seqDB search
MDSDGTIGDVTTHQLPHQLPPHPSAHHRQQRTFAQSSKLQDVLYEIRGPVHQQAARLEAE
GHRILKLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELVDGF
PRFDVDDVYLGNGVSELITMTLQALLDNGDEVLIPSPDYPLWTASTSLAGGTPVHYLCDE
TQGWQPDIADMESKITDRTKALVVINPNNPTGAVYTSEVLTQIVELARKHELLLLADEIY
DKILYGDAKHINLASLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHAGSFIEGINL
LANMRLCPNVPAQHAIQVALGGYQSIDDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPDG
ALYAFPRLDPEVYDIDDDEQLVLDLLLQEKILVTQGTGFNWPAPDHLRIVTLPWARDLAA
AIERLGNFLVAYRQ
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggacagtgatggcaccattggtgatgtgaccacccaccagctgccccatcagctgcca
ccgcacccgtcggcccatcaccggcagcagcgcactttcgcgcagtcgtcgaagcttcag
gacgtcctgtacgagatccgcggcccggtacatcagcaggccgcgcggctggaggccgag
ggtcatcgcatcctcaagctcaacatcggcaacccggcgccgttcggcttcgaggcgccc
gacgtgatcatgcgcgacatgatccaggccctcccctacgcgcagggctactccgactcg
caaggcatcctgccggcccgccgcgcggtggtcacccgctacgagttggtcgacggattc
ccccgcttcgacgtcgacgacgtctacctgggcaacggggtctccgagctgatcaccatg
acgctgcaggccctgctcgacaacggcgacgaggtgctgatcccgtcacccgactacccg
ctgtggacggcgtcgacgtcgctggccggcggcaccccggtgcactacctgtgcgacgag
acgcagggctggcagcccgacatcgccgacatggagtccaagatcaccgaccgcaccaag
gcgctggtggtgatcaacccgaacaacccgaccggcgcggtctacaccagcgaagtgctc
acgcagatcgtcgaattggcgcgcaagcacgagctgctgctgctcgccgacgagatctac
gacaagatcctctacggcgacgccaagcacatcaacctggcctcgctggcgccggacatg
ttgtgcctgacgttcaacgggctgtccaaggcctaccgcgtggccgggtatcgggccggc
tggctggcgatcaccgggcccaaggaccacgccggcagcttcatcgaggggatcaacctg
ctggccaacatgcgactgtgccccaatgtcccggcgcagcacgcgatccaggtcgccctc
ggcggctaccagagcatcgacgacctcgtcctgcccggcggccggctgctcgagcagcgc
gacgtcgcctggaccaagctcaacgagattccgggggtgtcctgcgtcaagccggacggc
gcgctctacgccttcccgcggctggaccccgaggtctacgacatcgacgacgacgagcag
ctcgtcctcgatttactgctgcaggagaagattctggtcacccagggcaccggcttcaat
tggcccgcaccggatcacctgcgcatcgtgaccctaccgtgggcccgcgatctggcggcg
gccatcgagcggctgggcaacttcctcgtcgcctatcgccagtaa

DBGET integrated database retrieval system