KEGG   Mycolicibacterium chitae: MCHIJ_41750
Entry
MCHIJ_41750       CDS       T06603                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00997  Biosynthesis of various secondary metabolites - part 3
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    MCHIJ_41750
Enzymes [BR:mcht01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     MCHIJ_41750
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: BBZ04738
LinkDB
Position
4381563..4382402
AA seq 279 aa
MFDNHGWRRRGDSGKRIRLSRIFNPHSRRALVVPMDHSVTMGPLGKADHADRTAEMLAAA
GADAIVVHKGRARSINPIHFTDMGLIIHLSAGTDLALDRTGKVLVGTVEECLRLGADAVS
VHVNVGSPTESAQLADLGAVSSACDMLGIPLLAMMYARGPNIGSPVELVDTLSHLAAIAT
DLGADLVKLDYAGNRSAMNDVVHSCPLPVLVAGGPSDSGDESAIAFGGEVAESNVAGLSF
GRLIFGADEPQRVAAELSRRLHSGRPAASRALSPTLESA
NT seq 840 nt   +upstreamnt  +downstreamnt
atgttcgacaaccacggttggcgtcgacgtggcgatagcggcaagcggattcgcttgtcc
cgcatcttcaatccgcattcgcggcgtgccctggtggtaccgatggaccactcggtgacc
atgggcccgctcggcaaagccgaccacgcggaccgcacggcggagatgctggcggccgcc
ggcgccgacgcgattgtcgtacacaagggtcgggcacggtcgatcaacccgatccacttc
accgacatggggttgatcatccacctgtcggccggaacggatctggcactggaccggacc
ggcaaggtgctggtcgggaccgtcgaagagtgcctccggctgggcgccgatgcggtcagc
gtccacgtcaacgtcggttcacccacggagtcggcacaattggccgacctcggcgccgta
tcgtcggcctgcgacatgctcggcatcccactgctggccatgatgtacgcacgcgggccg
aacatcggttccccggtggaattggtggacaccctgtcgcacctggcggcgatcgccacc
gacctcggcgccgatctggtcaaattggactacgcgggcaaccgcagcgcgatgaacgac
gtcgtgcactcctgtcccctgcccgtcctcgtcgcaggcggcccgtccgactccggcgat
gaatccgccatcgcgttcggcggcgaggtcgccgaatccaacgtggccggactgagtttc
gggcgcctcatcttcggggccgacgagccccaacgggtcgccgccgagctttcccgccgc
ctgcacagcggacggcccgcggcgtcccgagcgttgagtccgacgctcgaatccgcctga

DBGET integrated database retrieval system