KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_0010Help
Entry
Mesci_0010        CDS       T01401                                 

Definition
(RefSeq) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00061  Fatty acid biosynthesis
mci01100  Metabolic pathways
mci01212  Fatty acid metabolism
Module
mci_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Mesci_0010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mci01004]
    Mesci_0010
Enzymes [BR:mci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Mesci_0010
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     Mesci_0010
Lipid biosynthesis proteins [BR:mci01004]
 Fatty acid synthase
  Component type
   Mesci_0010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-GeneID: 10115449
NCBI-ProteinID: YP_004139235
UniProt: E8TLT7
LinkDB All DBs
Position
8470..8985
Genome map
AA seq 171 aa AA seqDB search
MAGKSSYEYDELLACARGELFGPGNAQLPYPPMLMFDRITEISETGGAFEKGFIRAEFDI
KPDLWFFACHFIGNPIMPGCLGLDAMWQLTGFYLGWLGEPGKGMALSTGEVKFKGMVTPS
VKKVEYGIDFKRVMRGRLVLGIADGWLKADGEPIYAATDLKVGLSKQSAVG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtaaatccagctacgagtacgacgaattgctggcctgcgcccgcggcgaactg
ttcggaccgggcaacgcccagcttccctatccgccaatgctgatgttcgaccgcatcacc
gagatcagcgagaccggcggcgccttcgagaagggttttatccgcgcggagttcgacatc
aagccggacctgtggttctttgcctgccatttcatcggcaatccgatcatgccggggtgc
ctcggcctcgacgccatgtggcaattgacgggcttctaccttggctggcttggcgaaccc
ggcaagggaatggcgctgtcgaccggcgaagtgaaattcaagggcatggtcacgccttcg
gtgaagaaggtcgaatatggcatcgacttcaagcgcgtgatgcggggccggctggtgctc
ggcatcgccgatggctggctgaaggcggatggcgaacccatatacgcggcaacggatttg
aaagtcggtctgtccaagcagtcggcggtcggctga

DBGET integrated database retrieval system