KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_0012Help
Entry
Mesci_0012        CDS       T01401                                 

Definition
(RefSeq) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00061  Fatty acid biosynthesis
mci00780  Biotin metabolism
mci01100  Metabolic pathways
mci01130  Biosynthesis of antibiotics
mci01212  Fatty acid metabolism
Module
mci_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Mesci_0012
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Mesci_0012
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Mesci_0012
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mci01004]
    Mesci_0012
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Mesci_0012
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Mesci_0012
Lipid biosynthesis proteins [BR:mci01004]
 Fatty acid synthase
  Component type
   Mesci_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 10115451
NCBI-ProteinID: YP_004139237
UniProt: E8TLT9
LinkDB All DBs
Position
10271..11083
Genome map
AA seq 270 aa AA seqDB search
MDGLMKGKRGLVMGVANDHSIAWGIARKLSEHGAELAFTYQGDAFGRRVKPLADKLGASL
VVPCDVEDSASVAATFETLGNEWGGLDFIVHAIGFSDKNELKGLYADTSRDNFVRTMVIS
CYSFTEVARHAATLMKDGGSMITLTYAGSVRVMPNYNVMGVAKAGLEASVRYLANDYGPR
GIRVNGISAGPVRTLAGAGISDARHMFSYQQRNSPLRRTVTIDEVGGSALYLLSDLSSGV
TGEIHYVDSGYHIVSMPTLDELKQTDGGRD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggacggattgatgaagggcaagcgcgggcttgtcatgggtgtcgccaacgatcattcg
atcgcctggggcatcgcccggaaattgtccgaacacggggcggaactcgccttcacctat
cagggcgatgccttcggacgccgggtcaagccgctggccgacaagctcggcgcctcgctg
gtcgtgccgtgcgacgtcgaggacagcgcttcggtcgccgccacgttcgagaccctgggc
aacgaatggggcgggctggatttcatcgtccacgccatcggcttttccgacaagaacgag
ttgaaaggcctctacgccgacaccagccgggataatttcgtccgcaccatggtgatctcc
tgctactccttcaccgaggtcgcccgccatgcggccaccttgatgaaggacggcggatcg
atgatcacgctgacctatgcgggctccgtccgcgtcatgccgaactacaatgtcatgggc
gtcgccaaggccggactggaggccagcgtgcgctacctcgccaacgattacggtccgcgc
ggcatcagggtaaacggcatatcggctgggcccgtgcgcacgctcgccggcgccggcatt
tcggacgcccgccacatgttctcctaccagcagcgaaactcgccactgcgccgcacggtg
accatcgacgaggtcggtggttcggcgctttatctgttgtcggatctgtcttccggggtt
accggcgaaatccactatgtcgattccggctatcacatcgtttccatgccgacgctcgac
gaattgaagcagaccgacggcgggcgagactaa

DBGET integrated database retrieval system