KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_0044Help
Entry
Mesci_0044        CDS       T01401                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00250  Alanine, aspartate and glutamate metabolism
mci00410  beta-Alanine metabolism
mci00640  Propanoate metabolism
mci00650  Butanoate metabolism
mci01100  Metabolic pathways
mci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Mesci_0044
   00650 Butanoate metabolism
    Mesci_0044
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mesci_0044
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mesci_0044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mci01007]
    Mesci_0044
Enzymes [BR:mci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mesci_0044
Amino acid related enzymes [BR:mci01007]
 Aminotransferase (transaminase)
  Class III
   Mesci_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 10115483
NCBI-ProteinID: YP_004139269
UniProt: E8TMR4
LinkDB All DBs
Position
complement(44683..45960)
Genome map
AA seq 425 aa AA seqDB search
MKNSAISERKNQSISRGVGMTTQIYADRAENSEIWDVEGRRYIDFSSGIAVVNTGHRHPR
VIEAVKAQLDRFTHTCHQVVPYESYVRLAERLNGMLPGKFEKKTIFVTTGAEAVENAIKI
ARNATGRQAVIAFAGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVYHAPFPVPLHGVSVA
DSLAALDRLFKADVDPARVAAIIIEPVQGEGGFYDAPRDFLVALRKLCDQHGMLLIADEV
QTGFARTGKMFAMDHHEVAADITTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGS
PIGVAAAHAVLDVIEDEKLCDRANTLGARLKQRLQSIRDDVPEIVDIRGLGFMNAVEFND
VKKGLPSAEIANAIRLKALDKGLILLTCGVYGNVIRFLAPITIQDEVMNEALDILESSIR
EVCAA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattcagccatttccgaacgcaagaaccaatcgatttcccgcggcgtcggcatg
accacgcagatttatgccgaccgggctgaaaattcggaaatctgggatgtcgaggggcgt
cgctatatcgatttctcatcgggcatcgccgtcgtcaacaccgggcatcgccatcccagg
gtgatcgaggcggtcaaggcacagctcgaccgcttcacccacacctgccaccaggtggtg
ccctatgagagctatgtgcgcctggccgaacggctgaacggcatgttgcccggcaagttc
gagaagaagacgatctttgtcaccaccggggccgaggctgtcgagaacgccatcaagatc
gcccgcaatgccaccggacgtcaggcggtcatcgccttcgccggcggtttccatggccgc
accttcatgggcatggcgctgaccggcaaggtcgtgccttacaaggtcggcttcggcgcc
atgccgggcgatgtctatcatgcgccgttccctgtgccgctgcacggtgtctcggtcgcc
gactcgctggcggcgctcgaccggttgttcaaggccgatgtggatccggcgcgcgtcgcc
gccatcatcatcgagccggttcagggcgagggcggcttctacgacgcgccgcgggatttc
ctggttgcgctgcgcaagctttgcgaccagcacggcatgctgctgatcgccgacgaagtg
cagaccggctttgcccgcaccggcaagatgtttgctatggatcaccatgaggtggccgcc
gacatcaccaccatggccaagagcctggccggcggctttcctctggcggcggtcaccggc
cgcgccgaaatcatggatgcgcccggccccggcgggctcggcggcacctatggcggcagc
ccgatcggcgttgccgcggcgcacgccgtgctcgacgtgatcgaggatgaaaagctgtgc
gatcgcgctaatacgctgggcgcaaggctgaaacagcggctgcagtcgatccgcgacgac
gtgcccgagatcgtcgacatcagaggtctcggcttcatgaacgctgtcgagttcaacgac
gtcaagaagggcctgccctcagccgagatcgccaatgcgatccggttgaaggcgctcgac
aagggcctgatcctgttgacctgcggcgtctacggcaacgtcatccgcttcctggcgccg
atcaccatccaggacgaagtcatgaacgaagcactcgacattctggaaagctcgatccgc
gaagtctgcgccgcctga

DBGET integrated database retrieval system