KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_0075Help
Entry
Mesci_0075        CDS       T01401                                 

Definition
(RefSeq) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci03030  DNA replication
mci03410  Base excision repair
mci03420  Nucleotide excision repair
mci03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mci00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Mesci_0075
   03410 Base excision repair
    Mesci_0075
   03420 Nucleotide excision repair
    Mesci_0075
   03430 Mismatch repair
    Mesci_0075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mci03032]
    Mesci_0075
   03400 DNA repair and recombination proteins [BR:mci03400]
    Mesci_0075
Enzymes [BR:mci01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mesci_0075
    6.5.1.6  DNA ligase (ATP or NAD+)
     Mesci_0075
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Mesci_0075
DNA replication proteins [BR:mci03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Mesci_0075
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Mesci_0075
DNA repair and recombination proteins [BR:mci03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Mesci_0075
   NER (nucleotide excision repair)
    Other NER factors
     Mesci_0075
   MMR (mismatch exicision repair)
    Other MMR factors
     Mesci_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-GeneID: 10115515
NCBI-ProteinID: YP_004139299
UniProt: E8TMU4
LinkDB All DBs
Position
79370..80971
Genome map
AA seq 533 aa AA seqDB search
MNRFAELLDRLVLTPSRNGKLTLLTDYFRSVEDPDRGLALAAITGDLHIAAVKPAMLRML
VTERMDPVLFGYSYDYVGDLAETVSLVWPQTPGNIPNREPTLGEVVAKLQAASRSDGPKV
LAGLLDSAGISARFAIIKLVTGGLRIGVSARLAKQALADFGKVEVAEIEELWHGLSPPYT
ALFAWLEGKAEKPRNTALALFRPVMLSNPVGDGDLEKLDPADYAAEWKWDGIRVQAVAEG
GIRRLYSRTGDDVSGAFPDLAEAMHFSATLDGELLVGDPREATGTFSDLQQRLNRKTVAP
KMQQQYPAFMRCYDLLQVGGEELRALPFRERRGRLESFVATLDPSRFDLSPFVDFTDWQT
LEELRRAPPHPIIEGVMLKRWDSAYVAGRPKGPWFKWKRDPHTVDAVLMYAQRGHGKRSS
FYSDYTFGVWTGAEGEEELVPVGKAYFGFTDEELKQIDKYVRDNTIERFGPVRSVRADRD
NGLVLEVAFEGLNRSTRHKSGVAMRFPRISRLRWDKPANEADRIETLQALLDR
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttcgccgaacttctcgaccgcctggtgctgacgccgtcgcgcaacggcaag
ctgaccttgctgaccgactatttccgcagcgtcgaggatcccgatcgcggcctggcgctg
gctgccatcactggcgatctccacatcgccgcggtcaagccggcgatgctgcgcatgctc
gtcaccgagcgcatggatccggtgctgttcggctattcctacgactatgtcggcgatctc
gccgaaacggtgtcgctggtctggccgcaaacgcccggaaacatcccgaaccgcgagccg
acgcttggcgaggtcgtcgccaagctgcaggcggcaagccgctccgacggaccgaaggtg
ctggcagggctgctcgacagcgccggcatctcggcacgctttgccatcatcaagctggtc
accggcggcctgcgcatcggcgtgtcggcgcgtctggccaaacaggcgctggcggatttc
ggcaaggtcgaggtcgcggagatcgaggagctctggcacgggctgtcaccgccttacaca
gcgttgttcgcctggctggaaggcaaggccgaaaagcccaggaacacggcgttggcattg
tttcgcccggtgatgctgtcgaacccggtcggcgacggcgatctcgaaaagctcgatccg
gccgattatgccgccgaatggaaatgggacggcatccgtgtccaggcggtggcggagggc
ggcatccgccggctctattcgcgcaccggcgatgacgtttcgggcgcctttccggacctc
gccgaggccatgcatttttccgcaacgctggacggcgaactgcttgtcggcgatccccgg
gaggcgacgggaaccttctccgatctgcagcaacggctgaatcgcaagacggtggcaccg
aagatgcagcagcaatacccggccttcatgcgctgctacgatctgctccaggtcggcggc
gaggaattgcgcgcgctgccgtttcgcgaacggcgcggccggctggaaagctttgtcgcg
acactcgacccgagccgtttcgatctgtcgccattcgtcgacttcacggactggcaaacg
ctggaggaactgcgccgggcgccgccgcatccgatcatcgaaggcgtcatgctgaagcgc
tgggactcagcctatgtcgccggccggccgaaaggtccgtggttcaagtggaaacgcgat
ccgcacacagtggacgcggtgctgatgtatgcgcagcgcggccacggcaagcggtcgagc
ttctattccgactatacgttcggtgtctggacaggtgccgaaggcgaagaggaactggta
ccggtcggcaaggcctatttcggcttcaccgacgaggaactgaagcagatcgacaaatat
gtccgcgacaacacgatcgagcgtttcgggccggtgcgctcggtgcgggccgaccgcgac
aacggcctggtgctggaagtcgccttcgaaggactgaaccgctcgacccggcacaaatcc
ggcgtcgccatgcgctttccccgcatttcgcgattgcgctgggacaagccggccaacgag
gccgaccgcatcgaaacgctgcaggcgctgctcgaccgataa

DBGET integrated database retrieval system