KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_0359
Entry
Mesci_0359        CDS       T01401                                 

Definition
(RefSeq) radical SAM protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB
Motif
Pfam: Radical_SAM HHH_3 HHH_5 HHH Fer4_12
Other DBs
NCBI-GeneID: 10115801
NCBI-ProteinID: YP_004139582
UniProt: E8TAB1
LinkDB
Position
396482..397717
AA seq 411 aa
MSALTVREKLAVLSDAAKYDASCASSGAAKKDSLESGGIGSTEGMGICHSYAPDGRCISL
LKILLTNFCIYDCSYCINRSSSNVRRARFGIDEVVKLTMDFYRRNYIEGLFLSSGVVRSP
DGTMGEMVEVARRLRLEEKFSGYIHLKTIPESSAELVEQAGLYADRLSINVELPTDEGVK
RLAPEKKPETIRLSMARLRQKMEEKAEPTLKTKKRERFAPGGQSTQMIIGADKTSDDGIL
HTSARLYGSYHLRRVYYSAFSPIPDSSSSLPLQKPPLMREHRLYQADWLMRFYGFSQPEI
LAGSSDGMLDLAIDPKLGWALRNRGQFPVDINRADREALLRVPGLGTKVVAKILETRRHR
RMRLEDVGRICQSIAKLRPFIIAEGWSPGALTDKAGLREKIASSCEQLSLF
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgagcgcactcaccgtccgtgaaaaactggctgtcctctccgatgccgccaaatacgat
gcgtcctgcgcctcgtcgggtgcggcgaaaaaggactcgctggaatcaggcggcatcggc
tccaccgagggcatgggcatctgccattcctacgcgccggacggccgctgcatttcgctg
ctgaaaatcctgctgaccaatttctgcatctatgattgcagctactgcatcaaccgttcg
tcttccaacgtgcggcgagcccgctttggcatcgacgaggtggtgaagctgaccatggat
ttctaccggcgcaactacatagaaggcctgttcctgtcctcgggcgtcgttcgctcgccg
gacgggaccatgggcgagatggtcgaagtggcacgccggctgcggctggaggagaagttc
tccggctatatccacctgaaaaccatcccggaaagctcggccgaactggtcgagcaggcc
ggtctctatgccgaccggctgtcgatcaatgtcgaactgccgaccgacgagggagtgaag
cggctggcgcccgagaagaagccggagacaatccggctttccatggccaggctgcgccag
aagatggaggagaaggccgagccgactttgaagaccaaaaagcgcgaacgctttgcgccg
ggcggccagtcgacgcagatgatcatcggcgccgacaagacatccgacgacggcatattg
cacacgagcgcccggctctatggcagctaccatctgcggcgggtctattactcggccttc
agtccgattccggattcgtcgtcgtcgctgcccctgcagaagccgccgctgatgcgtgag
caccggctttatcaggccgactggctgatgcggttttacggcttttcgcaaccggaaatc
ctcgccggcagcagcgacggcatgctcgatctcgccatcgacccgaagctgggctgggca
ctgcgcaaccgggggcagtttcccgtcgacatcaatcgcgccgaccgcgaagcgctgctg
cgggtgccgggtctcggcaccaaggtggtggcgaagattttggagacgcgtcggcaccgg
cgcatgcggctcgaggacgtcggacggatctgccagtcgatcgccaagctcaggcccttc
atcatcgccgaaggctggtcacctggcgcgctgaccgacaaggccggcctgcgcgaaaag
attgcctcctcctgcgaacagttgtcgttgttctga

DBGET integrated database retrieval system