KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_0783Help
Entry
Mesci_0783        CDS       T01401                                 

Definition
(RefSeq) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mci00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Mesci_0783
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mci03400]
    Mesci_0783
Enzymes [BR:mci01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mesci_0783
DNA repair and recombination proteins [BR:mci03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Mesci_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 10116228
NCBI-ProteinID: YP_004140002
UniProt: E8TFS2
LinkDB All DBs
Position
828227..830740
Genome map
AA seq 837 aa AA seqDB search
MASLEQYHSKRDFKKTAEPAGKVARTKQGEAGGIFVIHKHAATRLHYDLRLEHDGVLWSW
AVTRGPSLDPHEKRLAVHVEDHPIDYAPFEGTIPKGEYGGGSVIVWDEGTWIPEIDPAKA
MKKGHISFELRGHKLHGAWHLVRLKPRAGEKRDNWLLIKSDDAAARPGEDILKEAPESVK
SGLTIEEVGEGKTAKGEKPKVWHSNKPAAVKTKAGKRLDFIEPQLATLERDAPPGKDWLH
EVKFDGYRMQAQIAGTDVRLLTRTGLDWTKKFGGEIVAELAGLKCSDAILDGEVVVLADS
GVSSFALLQQDLSAKRTNRFIYYVFDLMRLDGRDLRREPLVERKQALQELLGEHSDNAAV
RFSDHFAEPGKIMLEHACRMGLEGVVSKRADAPYRSGRGPTWVKSKCTARQEFVIGGYLP
SDKTGRGLRSILVGFHEGGKLHYAGRVGTGFSGKGANELKAKLDALTAKSSPFSTAVPKG
KGLVWVKPELVGEVEFRSWTSDRIIRHASFQGLREDKPAEEVVQEKPKAATGMPSTGKST
AKPASGGKAAGSMTTTVKLSHPDKLLWPDENISKQGLLDHYAQVWPRMEQFVVNRPLSLV
RAPDGVGGQRFFQKHASAGMSDKIARMKDPTDGEEILFIRDFDGVAALVQYGVVEIHIWG
CTIDEIEKPDQIIFDLDPDEGVDVKAVREAALDIRGKLDELSLPNFVKTSGGKGYHVLVP
LKPAADWDAVKGFAHDFARALEQGAPDRYTATLSKKARTGKIFVDYLRNGRGSTTVAPYS
SRAKKGATVSMPVTWPEIEAGLPPNAFPIGDKTTLKQLAKADPWREFFKQGKTLKRG
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggccagcctcgaacaatatcactccaagcgcgatttcaagaaaaccgccgaaccggcc
ggcaaggtcgcccggaccaagcagggcgaggccggcggcatcttcgtcatccacaagcat
gccgcgacgcggttgcattacgacttgcggctcgagcatgatggcgtgctgtggagttgg
gcggtgacgcgcggcccgagcctcgacccgcatgagaagcgactggctgtccatgtcgag
gatcacccgatcgactatgcgccgttcgaaggcaccattcccaagggcgaatatggcggc
ggttcggttatcgtttgggacgagggcacctggattcccgagatcgacccggccaaggcg
atgaaaaagggccatatcagcttcgagctcaggggacacaagctgcatggggcatggcat
ctggtgcggctgaagccgcgtgcgggtgaaaagcgcgacaactggctgctgatcaagtcg
gacgatgccgcagcgcgtcccggcgaggacatcctcaaggaagcgcctgaatcggtgaaa
tcgggcctgaccatcgaggaggtcggcgagggcaagaccgcgaagggcgagaagccgaaa
gtctggcattccaacaagccggccgccgtcaagacaaaagccggcaaacgcctcgacttt
atcgagccgcagctggccacgctcgagcgcgatgcgccgccgggcaaggactggctgcat
gaggtgaagttcgacggctatcgcatgcaggcgcagatcgccggcaccgatgtgcggctg
ctgacccgcaccggcctcgactggacgaagaaattcggcggcgagatcgtcgcggagttg
gccgggctgaagtgcagcgacgccatcctcgatggcgaggtggtggtgttggccgacagt
ggtgtttcgtccttcgcgctgctgcagcaagacctgtcggcgaagcggaccaatcgtttc
atctattacgtgttcgacctgatgcgcctcgatggaagggatttgcggcgcgagccgctg
gtcgagcgcaagcaggccttgcaggaactgctcggcgaacactccgacaatgcggcggtc
cgcttcagcgaccatttcgccgaacccggcaagatcatgcttgagcatgcctgccggatg
ggcctggaaggcgtcgtctccaagcgtgccgatgcaccgtaccgcagcggccgcggccca
acctgggtgaagtcgaaatgcacggcgcggcaggagttcgtcattggcggctacctgccg
tcggacaagaccgggcgcggcctgcgctcgatcctggtcggcttccacgagggcggcaag
ctgcattatgccggccgcgtcggcactggtttttcgggcaagggcgccaatgagctgaag
gcaaaactcgatgcgttgacggcaaaatcatcgcccttctccaccgccgtgccgaagggc
aagggcctggtctgggtcaagcctgaacttgtcggcgaagtggagtttcgcagctggacc
tcggaccgtataatacgccacgcctcgttccaggggttgcgcgaggacaagccggcggag
gaagtcgtgcaggaaaagcccaaagcggcgacaggcatgccatcgacaggcaagagcacg
gccaagccggcatcaggcggcaaagccgccgggtcgatgacgaccacggtcaaactctcg
catcccgacaagctgctgtggccggacgaaaacatatccaagcagggcctgctcgaccat
tacgcacaggtttggccgcgcatggaacagttcgtggtcaaccggccgctcagcctggtg
cgggcgccggacggtgtcggcggccagcgtttcttccagaagcatgcctcggctggcatg
agcgacaagatcgcgcgcatgaaggacccgaccgacggcgaggaaatcctgttcatccgg
gatttcgatggtgttgccgcactggtccagtatggcgtggtcgagatccacatctggggg
tgcacgatcgatgagatcgagaagcccgaccagatcatcttcgatctcgatcccgatgaa
ggtgtcgatgtgaaggcggtccgcgaggcggcactcgatatccggggcaagctcgacgag
ctgtcgctgccgaatttcgtcaagacctcgggcggcaagggctatcacgtgctggtgccg
ctgaaaccggcggcggattgggatgcggtgaagggcttcgcccatgactttgcccgcgcg
ttggagcagggtgcccccgaccgctacacggcgacgctgtcgaaaaaagcgcgcacggga
aagatcttcgtcgactatctgcgcaacggcaggggctcgacgacggtcgcgccctattcc
tcgcgcgccaagaagggcgccaccgtgtcgatgccggtgacctggccagagatcgaggcc
ggcttgccgccgaacgctttcccgatcggcgacaagacgacgctgaagcagctggcgaaa
gccgatccgtggagggaatttttcaagcaggggaagacgttgaagcgggggtag

DBGET integrated database retrieval system