KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_1361Help
Entry
Mesci_1361        CDS       T01401                                 

Definition
(RefSeq) xylose isomerase domain-containing protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00040  Pentose and glucuronate interconversions
mci00051  Fructose and mannose metabolism
mci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mesci_1361
   00051 Fructose and mannose metabolism
    Mesci_1361
Enzymes [BR:mci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Mesci_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 10116810
NCBI-ProteinID: YP_004140571
UniProt: E8T7B6
LinkDB All DBs
Position
complement(1420876..1421865)
Genome map
AA seq 329 aa AA seqDB search
MTATRFATRLNSFASRPQAEWPDLTGKPSLLQMAARAAKVGGLTDLDLNFPDHVSEKPAE
IALKLSDLGLSINGFAMRYYSNPAFKLGAFTNPDPAVRREAIDLTKAGIDALREAGASLM
TLWLGQDGFDYAFQADYATLWQHEIDGIREVSAHDPDCQISLEYKPNEPRSYSLMPDAAT
TLLAIRDVGVPNLGVTLDFAHVLYADEQPAFAAALVARHSKLLGVHLNDGYAKRDDGLMV
GAVHTLQTIELLRQIRRDGYAGAIYFDTFPDMTGLDPVRECEVNIATVKRMLRVVDRLEQ
DNRLSAAMDSQDAVTSQAIIQEIMLGPDS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacagccactcgtttcgccacgcgcctgaattcctttgcctcgcggccgcaggccgaa
tggcctgatcttaccggcaagccgtcgctgctgcagatggcggcgcgcgccgccaaggtc
ggcgggcttaccgatctcgacctcaactttcccgaccatgtcagtgaaaagcctgcggaa
atcgccctcaaactgagcgatctcgggctttccatcaatggctttgccatgcgctactac
tccaaccccgccttcaagctcggcgccttcaccaatccggatccggcggtgcgccgcgag
gccatcgacctgaccaaagccgggatcgatgccctgcgtgaggccggcgccagcctgatg
acgctgtggctcggccaggatggcttcgactacgccttccaggccgactatgcgacgctt
tggcaacacgaaatcgatgggattcgtgaagtatccgcgcatgatcccgactgtcagatc
agccttgagtacaaaccgaacgaaccacgctcctacagcctgatgccggatgcggcgacg
accttgctggcgatccgcgatgtcggcgtgcccaatctgggcgtcaccctcgatttcgcc
catgtgctctatgccgacgaacagccggcctttgccgcggccctggtggcgcgccacagc
aagctgctcggcgtgcatctgaacgacggctacgccaagcgcgacgacggcctgatggtc
ggcgcggtgcacacgctgcagaccatcgagctgctcaggcagattcgccgcgacggttac
gccggcgccatctatttcgacacgttccccgacatgaccgggctcgatccggtgcgcgag
tgcgaagtcaacatcgccaccgtcaagcgcatgctgcgcgtcgttgaccggctggagcag
gacaatcgcctgtccgccgccatggacagccaggatgcggtgacgtcgcaggccatcatc
caggaaatcatgctcgggccggatagctga

DBGET integrated database retrieval system