KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_1397Help
Entry
Mesci_1397        CDS       T01401                                 

Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00030  Pentose phosphate pathway
mci00710  Carbon fixation in photosynthetic organisms
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
mci01200  Carbon metabolism
mci01230  Biosynthesis of amino acids
Module
mci_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mci_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
mci_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mci_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mesci_1397
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesci_1397
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Mesci_1397
Enzymes [BR:mci01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Mesci_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 10116846
NCBI-ProteinID: YP_004140607
UniProt: E8T7F2
LinkDB All DBs
Position
complement(1452356..1454347)
Genome map
AA seq 663 aa AA seqDB search
MTSREQHDRMANAIRFLSMDAVEKANSGHPGLPMGCADIATVLFTKFLKYDPKAPHWPDR
DRFILSAGHGSMLLYSLLHLTGYEDMTIDQIKHFRQLGSKTAGHPEYGHATGIETTTGPL
GQGLANSVGFALGERIMNAAFGNDLVDHYTYVLAGDGCLMEGVSQEAIALAGHLKLNKLI
VFWDNNNISIDGPVSLADNTDQVARFQASGWNASHIDGTDPEAIAYAIEAARHSDKPTMI
ACKTTIGFGAPTKAGTNKAHGSPLGADEIAGARKFFNWDSPPFEIPADILDAWRAAGKTG
AKPRTDWEGRLAKAEPKLKAEFERRLAGKLPSNFDAVIADYKKKLSADKPKVATRKSSEM
ALEVINGAVPETISGSADLTGSNNTKTSQTKNITPDDYGQRYVHYGIREHGMAAAINGLT
LHGGLIAYGGTFLCFSDYARPSMRLASLMGIRSIFVMTHDSIGLGEDGPTHQPVEHLAAL
RAIPNHNVFRPADAVETAECWQIALESEKTPSTLALTRQNLPTVRTEFSAKNLSSQGAYE
LAAASGEAAITIFATGSEVEIALGARELLEKHGHPTRVVSVPCFELFDQQSDDYRKKTIG
NAPIKMAIEAGIRQGWDHLIGSDGIFVGMTGFGASGTIEQLYPHFGITAEAAAKAAEARL
HAK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgcgtgaacaacatgaccggatggccaatgcgatccgctttctctccatggac
gccgtcgagaaggcaaactccggccatcccggcctgcccatgggctgcgccgacatcgcc
acggtgctgttcacgaagttcctgaaatatgatccgaaggccccccattggcccgaccgg
gatcgcttcatcctgtcggccggccacggttcgatgctgctctattcgctgctgcacctg
accggctacgaggacatgacgatcgaccagatcaagcatttccgccagttgggctcgaag
accgccggccatcccgaatacggccatgccaccggcatagagacgaccaccggcccgctc
ggccagggtctggccaattcggtcggcttcgcgctcggcgagcgcatcatgaacgcagcc
ttcggcaacgacctcgtcgaccattacacctacgtactggccggtgacggctgcctgatg
gaaggtgtttcccaggaagccatcgcgcttgccggccatctcaagctcaacaagctgatc
gtcttctgggacaacaacaacatctcgatcgacggcccggtctcgcttgccgacaacacc
gaccaggtcgcccgcttccaggcctcgggctggaacgccagccacatcgacggcaccgat
ccggaagccatcgcctatgccatcgaagccgctcgtcactccgacaagccgacgatgatc
gcctgcaagacgaccatcggcttcggcgctccaaccaaggccggcaccaacaaggcgcac
ggttcgccgctcggcgccgacgagatcgccggtgcgcgcaaattcttcaactgggactcg
ccgcccttcgagattccggccgacatccttgacgcatggcgcgccgccggtaaaaccggc
gccaagccgcgcaccgactgggagggacgtctggccaaggccgagcccaagttgaaggcc
gagttcgaacgccgcctcgccggcaagctgccgtcgaatttcgacgccgtcatcgccgac
tacaagaagaagctgtcggccgacaagccgaaggtcgccacccgcaaatcctcggaaatg
gcgctggaggtcatcaacggcgccgtgccggaaaccataagcggctccgccgacctgacc
ggctccaacaacaccaagaccagccagaccaagaacattacgcccgacgattacggccag
cgttatgtccactacggcattcgcgaacatggcatggcggccgccatcaatggcttgacg
ctgcatggcggcctcatcgcctatggcggcaccttcctgtgcttctccgactatgcccgc
ccgtcaatgcgtctggcttcgctgatgggcatccgctcgatcttcgtcatgacccatgat
tccatcggtctgggcgaagacggcccgacccaccagccggtcgagcatctggcggcattg
cgcgcgatccccaaccacaatgtcttccgcccggccgacgcggtcgaaaccgcggaatgc
tggcagatcgccctggagtcggaaaagacgccgtcgaccttggcgctgacccgccagaac
ctgccgacggtgcgcaccgaattctcggccaagaacctcagcagccagggagcctatgag
ctggccgccgccagcggcgaggcggcgataacgatcttcgccaccggctccgaggtcgag
atcgcacttggcgcgcgcgagctgttggaaaagcacggccatccgacccgcgtcgtctcg
gttccctgcttcgaactgttcgaccagcagagcgacgactaccgcaagaagacgatcggc
aatgcgccgatcaagatggcgatcgaagccggcatccgccagggatgggatcatctgatc
ggctcagacggcatcttcgtcggcatgaccggcttcggcgcgtcgggcacgatcgagcaa
ctctatccgcatttcggcattaccgccgaggccgcggccaaggcggcggaagcccgcctg
cacgccaagtaa

DBGET integrated database retrieval system