KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_1595Help
Entry
Mesci_1595        CDS       T01401                                 

Definition
(RefSeq) arginine biosynthesis bifunctional protein ArgJ
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00220  Arginine biosynthesis
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01130  Biosynthesis of antibiotics
mci01210  2-Oxocarboxylic acid metabolism
mci01230  Biosynthesis of amino acids
Module
mci_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Mesci_1595
Enzymes [BR:mci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     Mesci_1595
    2.3.1.35  glutamate N-acetyltransferase
     Mesci_1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-GeneID: 10117047
NCBI-ProteinID: YP_004140802
UniProt: E8TAK3
LinkDB All DBs
Position
1656785..1658026
Genome map
AA seq 413 aa AA seqDB search
MSTTISPLAPKKYPKMPEIEGVRIATAEAGIKYKGRTDLLTMVFDEGTAVAGVFTKSKCP
SAPVDFCRQNLGAGKARVLVVNSGNANAFTGKKGRESTALTGEAAAKAAGCTAAEVFMAS
TGVIGEPLDTSKFSHLLAGLVSNGKPELWTEAAKAIMTTDTYPKVATATVKLGDTDVTIN
GISKGAGMIAPDMATMLSFIATDAPIAAPVLQDLLSRGTAKTFNAVTVDSDTSTSDTLLI
FATGKAARRGAPEITDPKDARLGTFRRALGKVLKSLALQVVRDGEGARKQVEVTVTGAKS
ARSAKRIALSIANSPLVKTAVAGEDANWGRVVMAVGKAGEPADRDRLSIWFGDNRLAHEG
ERDPGYSEAATSAYMKRDDIRIRADIGIGRGKATVWTCDLTKEYVAINGDYRS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgacgatttcgccgcttgcgccgaagaaatacccgaaaatgccagaaatcgag
ggggtgcgcatcgccaccgccgaggccgggataaagtacaagggccgcaccgatcttttg
accatggtcttcgatgaaggcactgcggtcgccggcgtgttcacgaaatcgaaatgcccc
tcggcgccggtggatttctgccggcagaatctcggcgcgggcaaggcgcgggtgctggtc
gtcaattcgggcaacgccaacgccttcaccggcaagaagggccgcgagtcgaccgcactg
accggcgaggcggcggcgaaggcggccggctgcacggcagcggaggttttcatggcctcg
accggcgtcatcggcgagccgctcgacaccagcaaattcagccatctgctcgcggggctg
gtcagcaacggcaagcccgagctgtggaccgaagcggcaaaggcgatcatgaccacggat
acctatccgaaagtggcgaccgcgaccgtcaagctcggcgacaccgatgtcaccatcaac
ggcatttccaagggcgccggcatgatcgcgcccgacatggcgacgatgctctccttcatc
gccaccgacgcgccgatcgccgcccctgtcctgcaggatctgttgtcgcgcggcacggcc
aagactttcaacgcggtcaccgtcgacagcgacacctcgaccagcgacacgctgctgatc
ttcgccaccggcaaggccgccaggcgcggcgcgccggagataaccgatcccaaggatgcc
cgtctcggcacgttccgccgggcgctcggcaaggtgctgaaatcgctggcgctgcaggtg
gtgcgcgacggcgaaggcgcccgcaagcaggtcgaagtcaccgtcaccggcgccaaatcg
gcgcgctcggccaagcgcatcgcgctgtcgatcgccaattcgccgctggtcaagacggca
gtcgccggcgaggacgccaattggggacgcgtcgtcatggccgtcggcaaggccggcgaa
cccgccgatcgcgaccggctgtcgatctggttcggcgacaacaggctggcgcatgaaggc
gagcgcgaccccggctattccgaggccgcgacgtcggcctacatgaagcgcgacgatatc
cgcatccgcgccgatatcggcatcggccgcggcaaggcgacggtgtggacctgcgacctc
accaaggaatatgtcgccatcaatggcgattaccggagctga

DBGET integrated database retrieval system