KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_2116Help
Entry
Mesci_2116        CDS       T01401                                 

Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00240  Pyrimidine metabolism
mci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mesci_2116
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Mesci_2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-GeneID: 10117583
NCBI-ProteinID: YP_004141318
UniProt: E8TI10
LinkDB All DBs
Position
complement(2228470..2229081)
Genome map
AA seq 203 aa AA seqDB search
MAKLYFHYATMNAGKTTMLLQASYNYRERGMGTMLFVAGHYRKGDTGLISSRIGLETEAE
MFRDGDDLFARVAAHHAHTSVHCVFVDEAQFLEEEQVWQLARIADRLNIPVMCYGLRTDF
QGKLFSGSRALLAIADDLREVRTICRCGRKATMVVRLGPDGKVARQGEQVAIGKDVYVSL
CRRHWEEEMGRAAPDDFIGFIKG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttacttccactacgcgacgatgaacgccggcaagacgacgatgctcttg
caggcctcttacaattaccgcgagcgcggcatgggcacgatgctgttcgtcgccggccac
taccgcaagggcgatacaggcctgatctcgtcgcgcataggcctggagacggaagccgag
atgtttcgcgacggcgacgatctgttcgcccgcgtcgccgctcatcacgcgcatacgtcg
gtgcattgcgtcttcgtcgacgaggcgcagttcctcgaggaagagcaggtctggcagctc
gcccgcatcgccgaccggctgaacatcccggtcatgtgctacggcctgcgcaccgatttc
cagggcaagctgttttccggctcgcgcgcgctgctggccatcgccgacgatttgcgcgaa
gtgcgcaccatctgccgatgcggccgcaaggcgacgatggtcgtgcgcctcggccccgat
ggcaaggtggcgcgccagggcgagcaggtggcgatcggcaaggacgtctatgtctcgctc
tgccgccgccactgggaggaagagatgggccgcgccgcgccagacgacttcatcggcttt
atcaagggctga

DBGET integrated database retrieval system