KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_2640Help
Entry
Mesci_2640        CDS       T01401                                 

Definition
(RefSeq) nitrate ABC transporter inner membrane subunit
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00910  Nitrogen metabolism
mci02010  ABC transporters
Module
mci_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Mesci_2640
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mesci_2640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mci02000]
    Mesci_2640
Transporters [BR:mci02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Mesci_2640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 10118111
NCBI-ProteinID: YP_004141825
UniProt: E8T8K3
LinkDB All DBs
Position
2772255..2773145
Genome map
AA seq 296 aa AA seqDB search
MSIQTIEDTKVKAFPAKPAEVIAFTAKARRRFEPLAIAGKLASALVPPIIVIALMLVVWQ
IACSSPTSSLPPPTQVWNEAYDLIAHPFFDNGPQDIGLAWRVLISLQRVAVGFGLAAVVG
VALGALVGQSIWAMRGLDPVFQILRTVPPLAWLPLSLAAFRDSSPSAIFVIFITSIWPII
INTAVGVRNIPEDYRNVSRILRLNQFEFFVKIMVPAAAPYIFTGLRIGIGLSWLAIVAAE
MLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVTGFCLDRLVAAVGAFVTRGTTAK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccagactatcgaggacaccaaggtgaaggcctttcccgccaagccggcggag
gtcatcgccttcactgccaaggcacggcgccgcttcgagccgctcgccatcgccggcaaa
ctggcgagcgcgctggtgccgcccatcatcgtcatcgcgctgatgctggtcgtctggcag
atcgcctgttcgtcgccgacatcgagcctgccgccgccgacccaggtgtggaacgaggct
tacgacctgatagcgcatccgttcttcgacaatggcccgcaggatataggtctggcctgg
cgcgtgctgatctcgctgcagcgcgtcgccgtcggcttcggcctggcggcggtcgtcggc
gtcgcgctcggtgcgctggtcggccagtcgatctgggcgatgcgcggcctcgacccggtg
ttccagatcctgcgcacggtgccgccgctggcctggctgccgctgtcgctggcggcgttc
cgtgattccagcccgtcggcgatcttcgtcatcttcatcacctcgatctggccaatcatc
atcaacaccgcggtcggcgtgcgcaacattcccgaggactaccgcaacgtctcgcgcatc
ctgcggctcaaccagttcgaattcttcgtcaagatcatggtgccggccgccgcgccttac
atcttcaccggcttgaggatcggcatcggcctgtcctggctcgccatcgtcgccgccgaa
atgctgactggcggcgtcggcatcggcttcttcatctgggatgcgtggaactcgtcgcgg
ctgcccgacatcatcgtcgcgctcgcctatatcggcgtcaccggcttctgcctcgaccgg
ctggtcgcggcggtcggcgccttcgtcacccgcggcacaacggcaaagtga

DBGET integrated database retrieval system