KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3256Help
Entry
Mesci_3256        CDS       T01401                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00480  Glutathione metabolism
mci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mesci_3256
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mci02000]
    Mesci_3256
Enzymes [BR:mci01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mesci_3256
Transporters [BR:mci02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mesci_3256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 GST_N_4 Tom37 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 10118731
NCBI-ProteinID: YP_004142429
UniProt: E8TH54
LinkDB All DBs
Position
complement(3401679..3402425)
Genome map
AA seq 248 aa AA seqDB search
MKHEICKRADKLILVSHHLCPYVQRAAISLTEKGVPFERVDIDLANKPDWFKAISPLGKV
PLLRVQRNGEETVIFESAVILEFLEETQANPLHPADPYARARHRAWIEFGSATLNAIGRF
YSTSTEAGFLDESSALSAMLDRLEAELTDEPGGPWFASKHFSLVDAVYGPVFRYLDVFDR
IGDFGILDRKPLVRAWRQALSERPSIRQAVAPDYPQRLHTFLRAKGSYLSSLIGQNDPAT
ALRPVLSA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgaaatctgcaaacgcgccgacaagctcattctcgtcagccatcatctctgc
ccctatgtgcagcgcgccgcgatttcgctcaccgaaaagggcgtgccgttcgaacgcgtc
gatatcgacctcgccaacaagccggactggttcaaggcgatctcgccgctcggcaaggtg
ccgctgctgcgcgtgcagcgaaatggcgaggaaacggtgatcttcgaatcggccgtcatc
ctggaattcctcgaagagacgcaagccaatcccctccaccctgccgatccctatgcccgc
gcccggcatcgcgcatggatcgagttcggttcggcaaccctcaacgcaatcggtcggttc
tattcaacatcgaccgaggccggcttccttgacgaatccagcgcgctatccgccatgctc
gaccgtctcgaagccgagctgacggacgagcctggcggcccctggttcgccagcaagcac
ttttcgctggtcgacgccgtttacggtccggtcttccgctatctcgatgtcttcgaccgg
atcggtgatttcggcattcttgaccgtaagcccctcgtccgcgcctggcgccaggctttg
agtgaacgcccgtcgatcaggcaagccgtggcgccggactacccacagcgcctgcatacc
ttcctgcgggcaaagggatcgtacctttccagcctcattggccaaaacgatccggccacc
gcgcttcgaccagtcctatccgcttga

DBGET integrated database retrieval system