KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3547Help
Entry
Mesci_3547        CDS       T01401                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit beta
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00970  Aminoacyl-tRNA biosynthesis
mci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mci00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mesci_3547
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mci03029]
    Mesci_3547
Enzymes [BR:mci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Mesci_3547
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Mesci_3547
Mitochondrial biogenesis [BR:mci03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mesci_3547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 10119029
NCBI-ProteinID: YP_004142717
UniProt: E8TLB6
LinkDB All DBs
Position
3702024..3703523
Genome map
AA seq 499 aa AA seqDB search
MSLIDTRTPDAKRLVSGATGDWEIIIGLEVHAQITSEAKLFSGASTAFGAAPNANVSLVD
AAMPGMLPVINEECVKQAIRTGLGLKAQINHKSVFDRKNYFYPDLPQGYQISQFKQPIVG
EGTVIVSVGPDRQGEFEDIEVGIERLHLEQDAGKSMHDQHVTMSYVDLNRSGVALMEIVS
KPDMRSADEAKAYVTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRKPGGEFGTRCEIKNV
NSIRFIGQAIDYEARRQIAILEDGGKIEQETRLFDAAKSETRSMRSKEEAHDYRYFPDPD
LLPLEFDQAYVDALAKELPELPDDKKARLIASLGLSVYDASILVSEKPIADYFEKVAAGR
DGKLAANWVINDLLGQLNKAGKDIENAPVSPDQLGAVIDLIKDGTISGKIAKDLFEIVWN
EGGDPRQLVESRGMKQVTDTGAIEKAVDEVIAANPDKVEQARAKPSMAGWFVGQVMKVTG
GKANPQAVNDLVKTKLGIE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcatcgacacccgcacgcccgacgccaagcgccttgtttccggtgccaccggc
gactgggagatcatcatcggcctcgaggtccatgcccagattacatcggaagcaaagctg
ttttccggcgcctcgaccgctttcggcgcggcgcccaacgccaatgtcagcctggtcgat
gcggcgatgcccggcatgctgccggtcatcaacgaggaatgcgtcaagcaggcgatccgc
accggccttgggctgaaagcgcagatcaaccacaagtcggtcttcgatcggaagaactac
ttctatccagacctgccgcagggctaccagatctcgcagttcaagcagccgatcgtcggc
gagggcacggtgatcgtttccgttggccccgatcgtcagggcgaattcgaggacatcgag
gtcggcatcgagcggctgcatctggagcaggatgccggaaagtcgatgcacgaccagcat
gtgaccatgtcctatgtcgacctcaaccgctccggcgtggcgctgatggagatcgtctcc
aagcccgacatgcgctcggccgacgaagccaaggcttatgtcaccaagctgcgcaccatc
gtgcgctatctcggcacctgcgacggcaacatggacgaaggttcgatgcgcgccgacgtc
aacgtttcggtgcgcaagccgggcggcgagttcggcacgcgctgcgagatcaagaacgtc
aactcgatccgcttcatcggccaggccatcgactacgaggcgcgccggcagatcgccatt
ctcgaggatggcggcaagatcgagcaggagacgcggctgttcgacgccgccaagagcgag
acgcgttcgatgcgctccaaggaagaggcgcatgattaccgctacttccccgatccggac
ctcttgccgctggaattcgaccaggcctatgtcgatgcgctggccaaggaattgccggaa
ctgccagacgacaagaaggcgcggctgatcgcgtcgctcggcctgtcggtctatgacgcc
tcgatcctggtttcggaaaagccgatcgccgactatttcgagaaggtggccgccggccgc
gacggcaagctcgccgccaactgggtcatcaacgatctgctcgggcaattgaacaaggcc
ggaaaagacattgaaaacgctccggtttcccctgatcagcttggcgcggtcatcgatctg
atcaaggacggcaccatttccggcaagatcgccaaggacctgttcgagatcgtctggaat
gagggcggcgatccgcgccagctggtggagagccgtggcatgaagcaggtcaccgacacc
ggcgccatcgagaaggccgtagacgaggtgatcgcagccaaccccgacaaggtcgaacag
gcgcgcgccaagccgagcatggccggttggttcgttggccaggtgatgaaggtgaccggc
ggcaaggccaatccacaagcggtcaacgacctcgtcaagaccaagctgggcatcgagtag

DBGET integrated database retrieval system