KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3604Help
Entry
Mesci_3604        CDS       T01401                                 

Definition
(RefSeq) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Brite
KEGG Orthology (KO) [BR:mci00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mci03012]
    Mesci_3604
   03029 Mitochondrial biogenesis [BR:mci03029]
    Mesci_3604
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mci04147]
    Mesci_3604
Translation factors [BR:mci03012]
 Eukaryotic Type
  Elongation factors
   Mesci_3604
 Prokaryotic Type
   Mesci_3604
Mitochondrial biogenesis [BR:mci03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Mesci_3604
Exosome [BR:mci04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Mesci_3604
  Exosomal proteins of breast cancer cells
   Mesci_3604
  Exosomal proteins of colorectal cancer cells
   Mesci_3604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 10119089
NCBI-ProteinID: YP_004142774
UniProt: E8TLH3
LinkDB All DBs
Position
3759254..3760429
Genome map
AA seq 391 aa AA seqDB search
MAKGKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKRYDQIDAAPEEKARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPSIVVFLNKVDQVDDAELLELVELEVRELLTKNEFPGDDIPIVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPVRPLDKPFLMPIEDVFSISGRGTVVTGRVERGVVKVGEEL
EIIGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDREGVERGQVLAKPGTVKPHK
KFVAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVSLPEGTEMVMPGDNITVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVVTIKE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgagcgtaacaagcctcacgtgaacatcggcacgattggccac
gtcgaccatggcaagacgtcgctgacggcggcgatcaccaagtattttggcgaatacaag
cgctacgaccagatcgacgctgcccctgaagagaaggcgcgcggcatcacgatctcgacg
gctcacgtcgaatacgagacggccaaccgccattacgctcacgtcgactgccccggccac
gccgactatgtgaagaacatgatcaccggcgccgcgcagatggacggcgcgatcctggtc
gtgtcggctgccgacggcccgatgccgcagacccgcgagcacatcctgctggcccgtcag
gtcggcgtgccgtcgatcgtggtgttcctgaacaaggtcgaccaggtcgacgacgccgag
ctgctcgaactggtcgagctcgaggttcgcgagcttctgaccaagaacgaattccccggc
gacgacattccgatcgtcaagggttcggctctggctgctctcgaagactcggacaagaag
atcggtgaagacgcgatccgcgagctgatggctgcggtcgatgcctacatcccgacgccg
gttcgtccgctcgacaagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggcacggtcgtgaccggccgcgtcgagcgcggcgtggtcaaggtcggcgaggagctg
gaaatcatcggcatccgtccgacgaccaagacgacctgcacgggcgtggaaatgttccgc
aagctgctcgatcagggccaggccggcgacaacatcggcgcgctgctgcgcggcgttgat
cgtgaaggtgtcgagcgcggccaggttctggccaagccgggcacggtgaagccgcacaag
aagttcgtggccgaagcctacatcctgaccaaggacgaaggtggccgtcacacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgaccgacgtgaccggcatcgtgtcg
ctgccggaaggcaccgagatggtgatgccgggcgacaacatcacggtcgatgtcgagctg
atcgtgccgatcgccatggaagagaagctgcgcttcgctatccgtgaaggcggccgcacc
gtcggtgccggcatcgtcgtcaccatcaaggaataa

DBGET integrated database retrieval system