KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_4035Help
Entry
Mesci_4035        CDS       T01401                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00564  Glycerophospholipid metabolism
mci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mesci_4035
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Mesci_4035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_3 FAD_binding_2 Mqo NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 10119524
NCBI-ProteinID: YP_004143198
UniProt: E8TAZ4
LinkDB All DBs
Position
complement(4166707..4168233)
Genome map
AA seq 508 aa AA seqDB search
MDASPIRDIFVIGGGINGCGIARDAVGRGFSVFLAEMNDLASGTSSGSTKLIHGGLRYLE
FYEFRLVREALMEREVLWKNAPHIIWPMRFVLPYAKGLRPAWLIRLGLFLYDHIGGRKLL
PATRTLDMARDPAGKPLKPLFKKAFEYSDGWVNDARLVALNARDAADRGATVRTRTKVTG
ARRENGLWTVQVEDLQTGETEEIKARLLVNAAGPWVDHVLSGVVGLNDVHNVRLVQGSHI
VIARKFDDPRAYFFQNRDGRIIFAIPYEEEFTLIGTTDQDYPGDPHDVRISDTEIDYLCA
AASEYFAEAVKRSDIVWTYSAVRPLYDDGASKAQEATRDYVLKADGGEGAAPIVNAFGGK
ITTYRRLSESMLEKIEGFLGKRGKPWTANAPLPGGDFPATGFDAEVAKLKTAYPFLDARL
ARRLTRLYGTRARMLLGLAKSNVDLGRNFGADLYEAEVRYLVQNEWAVTSEDVLWRRTKR
GLHLSREQVAALDEFMHGISRRHVAAAE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcatctccgatccgtgacattttcgtcataggcggcggcatcaatggctgcggt
atcgcccgcgacgccgtcgggcgtggcttttccgtctttctcgccgagatgaacgacctc
gccagcgggacttcctcgggctcgaccaaattgatccatggcggcctgcgctacctcgaa
ttctacgaattccgcctggtgcgcgaagcgctgatggagcgcgaggttctttggaagaac
gcgccgcacatcatctggccgatgcgcttcgtgctgccctatgccaagggcctgcgcccg
gcctggctgatcaggctcggtctcttcctctacgaccacattggtgggcgcaaattgctg
ccggcgacccggacgctggacatggccagggatccggccggcaagcctttgaagccgcta
ttcaagaaggccttcgaatattcggatggctgggtcaatgatgcgcggctggtggcgctg
aatgcacgtgatgcggccgaccgcggcgcaacggtccgcacccgcacgaaagtgaccggc
gcgcgccgcgaaaacggcttgtggacggtccaggtcgaggatctgcagaccggcgagacc
gaggagatcaaggcgcgcctgctggtcaatgccgccggcccctgggtcgatcatgtgctt
tccggcgtcgtcggcctcaacgatgtgcacaatgtccgcctcgtgcagggcagccacatc
gtcatcgccaggaagttcgacgatccgcgcgcctatttcttccagaacagggatggtcga
atcatcttcgccattccctacgaggaagagttcaccctgatcggcaccacggaccaggat
tatcccggtgatccgcatgacgtgaggatcagcgacaccgagatcgactatctctgcgcc
gcagcaagcgaatatttcgctgaagccgtcaagcgctcggacatcgtctggacctattcc
gccgtccgtccgctctatgatgacggagcctccaaggcgcaggaagcgacgcgcgactat
gtgctcaaggccgatggcggcgagggtgccgccccgatcgtcaacgccttcggcggcaag
atcaccacctatcgccggctgtcggaatcgatgctggaaaagatcgagggttttctgggt
aaacgcggcaagccgtggacggcaaacgcgccgttgccgggtggcgatttcccggccacc
ggtttcgatgccgaagtggcgaaactgaagaccgcctatccgttcctcgacgcgcgcctg
gctcgccggctgacccggctctatggcacccgcgcaaggatgctgctggggctggccaaa
tcgaacgtcgatctcggccgcaacttcggcgccgatctctacgaggccgaggtgcgctat
ctcgttcaaaacgaatgggccgtcacatcggaagatgtattgtggcgccgtaccaagcgc
ggtctgcatctcagccgcgagcaggtggcggctctcgatgaattcatgcacggcataagc
cggcgccatgtcgcggctgccgaatga

DBGET integrated database retrieval system