KEGG   Mesorhizobium ciceri: Mesci_4283Help
Entry
Mesci_4283        CDS       T01401                                 

Definition
(RefSeq) ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00630  Glyoxylate and dicarboxylate metabolism
mci00710  Carbon fixation in photosynthetic organisms
mci01100  Metabolic pathways
mci01120  Microbial metabolism in diverse environments
mci01200  Carbon metabolism
Module
mci_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mci_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mesci_4283
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesci_4283
Enzymes [BR:mci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mesci_4283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 10119774
NCBI-ProteinID: YP_004143443
UniProt: E8TEA0
LinkDB All DBs
Position
4421809..4423302
Genome map
AA seq 497 aa AA seqDB search
MNKIDILPAGTLKEGKERYKSGVIPYKKMGYWEPDYRPKETDLIAMFRITPQPGVDHEEA
AAAIAGESSTATWTVVWTDRLTACELYRAKAFRSEPVPNTGPGTKTEQQYFAYIAYDLDL
FEPGSIANLTASIIGNVFGFKAVKALRLEDMRIPVAYLKTFQGPATGIVVERERLDKFGR
PLLGATTKPKLGLSGRNYGRVVYEALKGGLDFVKDDENINSQPFMHWRDRFLYCMEAVNK
ASAATGEVKGHYLNVTAGTMEEMYERAEFAKQLGSCIVMIDLVIGYTAIQSMAKWARRND
MILHLHRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLMIKGFYDT
LREERTPQNLETGLFFDQEWASLNKVMPVASGGIHAGQMHQLIHYLGEDVILQFGGGTIG
HPDGIQAGATANRVALEAMILARNEGRDYLREGTKILEQAARWCTPLKAALETWKDVTFN
YESTDTADFVPTATPSF
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatcgacatactgccagcggggacgctcaaggaaggcaaggagcgctacaag
tcaggggtcatcccctacaagaagatgggctactgggagcctgactacaggcccaaggaa
accgatctgatcgccatgttccggatcacgccgcaacccggtgtcgaccacgaggaggcg
gcagccgccatcgccggtgaatcctccaccgcgacgtggaccgtggtgtggaccgaccgg
ctgacagcttgcgagctctatcgcgccaaggcgttcagatccgagccggtgccgaacacc
ggtcccggaaccaagaccgagcaacagtacttcgcctacatcgcctacgacctcgacctg
ttcgagccgggctcgatcgccaacctgaccgcatcgatcatcggcaatgtgttcggcttc
aaggcagtcaaggcgttgcggctggaagacatgcgtatcccggtggcgtatctcaaaact
ttccaggggccggcgaccggcatcgtggtggagcgtgagcggctcgacaagttcggccgg
ccgctgctcggcgcaacgacgaagccgaagctcggcctgtcgggacgcaattacgggcgc
gtcgtttatgaagcgctgaagggcggcctcgacttcgtcaaggacgacgagaacatcaac
tcgcagcccttcatgcattggcgcgaccgcttcctctactgcatggaggccgtgaacaag
gcgtcggccgccaccggcgaggtcaaaggccattatctcaacgtcaccgccggcacgatg
gaggagatgtacgagcgcgccgaattcgccaagcaacttggctcctgcatcgtcatgatc
gacctcgtcatcggctacacggcgatccagtcgatggccaagtgggcacgccgcaacgac
atgatcctgcacctgcaccgtgccggcaactcgacctattcgcgccagaagaaccacggc
atgaatttccgcgtcatctgcaaatggatgcgcatggccggcgtcgaccatatccatgcc
ggcacggtggtcggcaagctggaaggcgacccgctcatgatcaagggattttatgacacg
ctgcgcgaggagcgcacgcctcagaacctcgaaaccgggctgttcttcgatcaggaatgg
gcctcgctcaacaaggtgatgcccgttgcctcgggcggcatccatgccggccagatgcac
cagttgatccactatctcggcgaggacgtcatcctgcagttcggcggcggcacgatcggc
catccggacggtatccaggcaggcgcgacggccaatcgcgtcgccttggaagcgatgatc
ctggcccgcaacgaggggcgcgattatttgcgcgaagggaccaagatcctcgaacaggcg
gccagatggtgcacgccgctgaaggctgccctggagacctggaaggacgtcaccttcaac
tacgaatcgaccgacacggccgacttcgtgccaaccgcaacgcccagcttctag

DBGET integrated database retrieval system