KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_4284Help
Entry
Mesci_4284        CDS       T01401                                 

Definition
(RefSeq) ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00630  Glyoxylate and dicarboxylate metabolism
mci00710  Carbon fixation in photosynthetic organisms
mci01100  Metabolic pathways
mci01120  Microbial metabolism in diverse environments
mci01200  Carbon metabolism
Module
mci_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mci_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mesci_4284
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesci_4284
Enzymes [BR:mci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mesci_4284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 10119775
NCBI-ProteinID: YP_004143444
UniProt: E8TEA1
LinkDB All DBs
Position
4423321..4423755
Genome map
AA seq 144 aa AA seqDB search
MMTNPGNKVTQGQFSFLPDLTDEQISAQIKYALKNHWAVSVEYTDDPHPRNTYWEMYGNP
MFDLKDPAGILLEVNACRKACPNMYVRVTAFDSTKGWEAPRMSFIVNRPPSEPGFRLLRQ
ERDGRSQGYSIVPYATDRPEGERS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaatccgggaaacaaggtcacacaggggcagttctcgttcctgcccgacctg
accgacgagcagatttcggcgcagatcaaatacgcgctgaagaaccattgggcggtcagc
gtcgagtacacggacgatccgcatccgcgaaatacctattgggaaatgtacggcaacccg
atgttcgacttgaaagatccggcgggcatactgctcgaggtcaatgcttgccggaaagcc
tgtccgaacatgtatgtgcgggtgaccgccttcgattcgaccaagggctgggaagcgccg
cgcatgtcgttcattgtcaaccggccgcccagcgaacccgggttccggctgctgcgccag
gagcgtgacggccgcagccagggttattcgatcgtgccttatgcgaccgacaggcccgag
ggcgagcggagctag

DBGET integrated database retrieval system