KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_4603Help
Entry
Mesci_4603        CDS       T01401                                 

Definition
(RefSeq) secretion protein HlyD family protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Brite
KEGG Orthology (KO) [BR:mci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mci02000]
    Mesci_4603
Transporters [BR:mci02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   Mesci_4603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 HlyD OEP
Motif
Other DBs
NCBI-GeneID: 10120098
NCBI-ProteinID: YP_004143762
UniProt: E8TIL0
LinkDB All DBs
Position
complement(4742091..4743272)
Genome map
AA seq 393 aa AA seqDB search
MNAVAKIDEKVTELEMEAPAQPAAAPATVAPPVQPAPAPVKKKRRLGRFLLMVALPAALA
VGGGYVWVTGGRYQETENANLQQAKVSIASDTAGRIVKVDIFDNQLVKQGDELFAIDPEP
YRIALAQADAAVAGARLNVEQLRAAYGQSMAQQKSDASQVAFAQSQFDRAADLAQKGINA
KSSLDEAKNDLDKAKQQLAVAEQGIISAKAALGGNPDIETDKHPTVMAALAARDKAAYDL
AQTTVKAPADGIVSQASSFKVGQYVGSGTPLFSLVETGDTWIDANFKETQLTHMKPGQKA
EIVVDTYPGRTFEATVKAIGAGTGAEFSLLPAQNATGNWVKVTQRIPVRLELTDADAKMA
LRTGMSATVTVDTGVARGLPSIFGHATAGEAAQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggtagccaagatagacgagaaagtgaccgaactggaaatggaagcgccggcg
cagccggccgcggccccggcaaccgttgctcccccggtgcagccggctccggcgccggtg
aagaaaaagcgccggctgggccgcttcctgctcatggtcgcgctgcctgcggcattggct
gttggcggcggctatgtctgggttaccggcggccgttatcaggagaccgagaacgccaat
ctgcagcaggccaaggtgtcgatcgcttccgacacggccggccgcatcgtcaaggtcgac
atcttcgataaccagctggtcaagcagggtgacgagctgtttgccatcgaccccgagccc
taccggatcgcgttggcgcaggccgacgcggcggtggcgggcgcgcgtctcaatgtcgag
cagttgcgcgccgcctatggccagtcgatggctcagcagaagtccgatgccagccaggtc
gccttcgcccagtcgcagttcgaccgcgccgccgatcttgcccagaagggcatcaacgcc
aaatcgtcgctggacgaagccaagaacgatctcgacaaggccaagcagcagctcgccgtt
gccgagcaaggcatcatcagcgccaaggcagcccttggcggcaatcccgacatcgaaacc
gacaagcatccgaccgtgatggccgcgctcgccgcgcgcgacaaggccgcctacgacctg
gcgcagaccacggtcaaggcgccggctgacggcatcgtcagccaggcctcgtcgttcaag
gtcggccagtatgtcggttccggcacgccgctgttttcgctggtcgagaccggcgacacc
tggatcgatgccaatttcaaggaaacgcagctcacccacatgaagcccggccagaaggcc
gagatcgtggtcgacacctatccggggcgcaccttcgaggcgacggtcaaggcgatcggc
gccggcacgggagccgagttctcgctgctgccggcccagaatgccaccggcaactgggtc
aaggtcacacagcgcatcccggttcgtctcgaactgaccgatgcggacgccaagatggcg
ttgcgcaccggcatgagcgccaccgttaccgtcgacaccggcgtggcgcgtggcctgcct
tcgatcttcggtcacgccacggccggcgaggccgcgcagtaa

DBGET integrated database retrieval system