KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_4908Help
Entry
Mesci_4908        CDS       T01401                                 

Definition
(RefSeq) manganese/iron superoxide dismutase-like protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Brite
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Mesci_4908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 10120406
NCBI-ProteinID: YP_004144064
UniProt: E8TNL9
LinkDB All DBs
Position
complement(5041797..5042396)
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGLGDLSVEEVVKQS
FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGALQKAVDSDLGGYDKFKADFIAAGT
TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDHVLELYEKAK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgaattgcccgctctgccttacgactatgaggccttgcagccttacatgtcg
aaagagacgctggaatatcaccacgacaagcaccacaaggcgtatgtcgataacggcaac
aaactcgccgccgaggccggcttgggcgatctgtcggtcgaagaggtggtcaagcagtcg
ttcggcaagaatgccggcctcttcaacaatgccgcccagcattacaaccacatccatttc
tggaagtggatgaagaaaggcggcggcggcaacaagctgccgggcgccttgcagaaggca
gtcgatagcgatctcggcggctacgacaagttcaaggccgacttcattgccgctggcacg
acacagttcggctccggctgggcctgggtctcggtcaaggatggcaagctggcgatctcc
aagacaccgaacggcgaaaacccgctcgtccatggcgcgtcgccgatcctcggcgtcgat
gtctgggagcactcctactacatcgactaccgcaacgcccggccgaaatatctcgaggcg
ttcgtcgacagcctgatcaactgggaccatgtcctggaattgtacgaaaaggcgaagtga

DBGET integrated database retrieval system