KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_5050Help
Entry
Mesci_5050        CDS       T01401                                 

Definition
(RefSeq) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00061  Fatty acid biosynthesis
mci00780  Biotin metabolism
mci01100  Metabolic pathways
mci01130  Biosynthesis of antibiotics
mci01212  Fatty acid metabolism
Module
mci_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Mesci_5050
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Mesci_5050
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Mesci_5050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mci01004]
    Mesci_5050
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Mesci_5050
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Mesci_5050
Lipid biosynthesis proteins [BR:mci01004]
 Fatty acid synthase
  Component type
   Mesci_5050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-GeneID: 10120550
NCBI-ProteinID: YP_004144200
UniProt: E8T839
LinkDB All DBs
Position
complement(5199471..5200289)
Genome map
AA seq 272 aa AA seqDB search
MAGGQGLMAGKRGLILGVANNRSIAYGIAKACVDHGAEIALTYQGEAFKKRVEPLAAELG
AFVAGHCDVTDPASLDEVFANVAKHWGKLDFLVHAIAFSDKDELTGRYVETSRDNFLRTM
DISVYSFTTIAKRAEALMTDGGSLLTLTYYGAEKVMPHYNVMGVAKAALEASVRYLAVDL
GAKKIRVNAISAGPIKTLAASGIGDFRYILKWNEYNSPLKQTVTQEEVGDSGVYFLSDLS
RGVTGEVHHVDSGYHVVGMKAVDAPDISTVKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtggacagggcctaatggccggcaagcgcggcctcattcttggcgtcgccaac
aataggtcgatcgcttatggcatcgccaaggcctgcgtcgatcatggcgccgagatagcg
ctgacctatcagggcgaggcgttcaagaagcgtgtcgagccgctggcggcggaactaggc
gcctttgtcgccggccattgcgacgtcaccgatccggcgagcctggatgaggttttcgcc
aatgtcgccaaacattggggcaagcttgatttcctcgtccacgccattgccttctccgac
aaggatgagctgaccggccgctatgtcgagacttcacgcgacaatttcctgcgcacaatg
gacatttcggtctattccttcaccactatcgccaagcgcgccgaggcgctgatgaccgat
ggcggctcgctgctgacgctgacctactacggcgccgaaaaggtgatgccgcactacaac
gtcatgggtgtcgccaaggcggcgctcgaggccagcgtgcgctacctggcggtcgatctc
ggcgccaagaagatacgcgtcaacgccatttcggccggcccgatcaagacccttgccgct
tccggcatcggcgatttccgctacatcctgaagtggaacgagtacaattcgccgctgaag
cagacggtgacgcaggaggaagtcggcgattccggcgtctatttcctgtccgacctgtcg
cgcggcgtcaccggtgaagtgcaccacgtcgattcgggctaccacgtcgtcggcatgaag
gcggtcgacgcgcctgatatttcgaccgtcaaggactaa

DBGET integrated database retrieval system